DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: santa-maria and cd36

Sequence 1:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001002363.1 Gene:cd36 ZFINID:ZDB-GENE-040718-55 Length:465 Species:Danio rerio

Alignment Length:479 Identity:140/480 (29%)
Similarity:236/480 (49%) Gaps:56/480 (12%)


  Fly    21 IFGFCLGLFGILCGMFWVDLFDWI----MHKEMALAPDTRVYENWKSPPIDLSLDIYLYNWTNPE 81
            |.|..||....|.|...:.:.|.|    :|||..|...|..::.|.|..|.:....:::|..||:
Zfish    11 ITGAVLGALIALLGGILIPVGDMIIKNTVHKETVLENGTLAFDTWTSVDIAMYRQFWIFNVENPD 75

  Fly    82 DFGNLSTKPILEQVGPYRF-IERPDKVDIHWHPENASVTYRRRSLFYFDAAGSNGSLDDEITTLN 145
            ...:..:||:|.|.|||.: :....|.:|.:: :|.:|::...:...|:.:.|.||.:|..|:||
Zfish    76 KVLSEGSKPVLVQKGPYTYRVRYIPKTNITFN-DNNTVSFVLPAGATFEPSMSVGSEEDVFTSLN 139

  Fly   146 AVALSAAATAKYWPPVKRSLVDVGLKMYGAEMSVQKSIDELLFTGYNDAMIDVAMAMPIFGDEVK 210
               |:.|...:...|   .|.|..::..|:.:...:::.|||: ||.|.|::..:          
Zfish   140 ---LAVAGVYRLIGP---KLADWLIRSSGSSLFQNRTVKELLW-GYKDPMLNSLV---------- 187

  Fly   211 VPFDKFGWFYTRNGSADLTGVFNVFTGADQLAKLGQMHSWNYQENTGFF-DSYCGMTNGSAG-EF 273
                  |.||..||:.|  |.:.||||.|.:.|:..:..|..:.:..:: ||||...|||.| .|
Zfish   188 ------GAFYPYNGTVD--GPYTVFTGKDDINKVAIIERWQGETSVNYWNDSYCDKINGSDGSSF 244

  Fly   274 QPQHLKPGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFSGGPRSVDNGTQYPENLCFCGG--- 335
            .| .|...:.:..|:||:||:|..:|..||:::|::.|::.....::.:....|:|:|:|..   
Zfish   245 HP-FLDKKEPLYFFSPDICRSISAEYEATVNLKGIDVYRYLLPVDALASPVSNPDNMCYCTDHEI 308

  Fly   336 --QCVPSGVMNISSCRFGSPVFMSYPHFFNADPYYPDQVEGLSPNQKDHEFYMVVQPSTGIPLEV 398
              .|..:|:::|:||: |:|||:|.|||..|.......|.|::||..:|..::.|:|.||..|..
Zfish   309 TRNCTLAGLLDITSCK-GTPVFISLPHFLYASIELQQGVVGMNPNLDEHSIFLDVEPITGFTLRF 372

  Fly   399 AARFQVNMLVEPIQGISLYTGI-PRIFFPLVWFEQKVRITPDMA-----------DQLKVLPIVM 451
            :.|.||||:..|...|:|...| .....|::|..:...:..:.|           |.|:.|.|.:
Zfish   373 SKRLQVNMMYGPSDDIALLNKIKEHTIIPILWLNETAVLDDETAKMFKNELISRMDMLEGLQIGL 437

  Fly   452 L--SGHIFAGICLIVGITLLCWTP 473
            |  ...||.| |:| |:.::|..|
Zfish   438 LVTGSAIFLG-CMI-GLIVVCSKP 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 139/478 (29%)
cd36NP_001002363.1 CD36 17..450 CDD:279474 133/462 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.