DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: santa-maria and scarb1

Sequence 1:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster
Sequence 2:XP_017213428.1 Gene:scarb1 ZFINID:ZDB-GENE-031126-1 Length:511 Species:Danio rerio

Alignment Length:513 Identity:150/514 (29%)
Similarity:252/514 (49%) Gaps:32/514 (6%)


  Fly    17 LIIGIFGFCLGLFGILCGMFWVDLFDWIMHKEMALAPDTRV-YENWKSPPIDLSLDIYLYNWTNP 80
            |::|......|...:..|...:|  |.|: |.:.:.|...: |..||..|:...:.:|.::..||
Zfish    12 LVLGGMALLFGTVLVFVGPIIID--DQIV-KNVEINPKNDLSYTMWKDIPVPFFMSVYFFHIVNP 73

  Fly    81 EDFGNLSTKPILEQVGPYRFIERPDKVDIHWHPENASVTYRRRSLFYFDAAGSNGSLDDEITTLN 145
            ::... ..:|::.|.|||.:.|...|.:|.:| ||.:|:|:....::|:.:.|.|...|.:|..|
Zfish    74 DEILK-GERPMVIQRGPYVYRENRWKDNITFH-ENHTVSYKEYRQYFFEESMSVGDESDVVTIPN 136

  Fly   146 AVALSAAATAKYWPPVKRSLVDVGLKMYGAEMSVQKSIDELLFTGYNDAMID-----VAMAMPIF 205
            .:.|.|:...:..|...|.|:....|.:.....:.|.:.||:: ||:..::|     :...:|..
Zfish   137 MLVLGASVMMENMPFPVRLLLSTTFKTFNEGPFLTKPVGELMW-GYDSKLVDFLNKYLPGMLPSS 200

  Fly   206 GDEVKVPFDKFGWFYTRNGSADLTGVFNVFTGADQLAKLGQMHSWNYQENTGFFDS-YCGMTNGS 269
            |        |||.|...|.|.  ||:|.:|||.|.:.|:..:.|||..:|..::.| .|.|.||:
Zfish   201 G--------KFGLFADFNNSN--TGLFTIFTGRDDIRKVHMVDSWNGLKNVDYWRSDQCNMINGT 255

  Fly   270 AGEFQPQHLKPGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFSGGPRSVDNGTQYPENLCFCG 334
            ||:..|..:....::..::||.||::.|.|...:...|:..|::........||..:|.|..|| 
Zfish   256 AGQMWPPFMTKETTMPFYSPDACRSMELVYQRPLVSSGIPVYRYVSPKTLFANGADFPPNEGFC- 319

  Fly   335 GQCVPSGVMNISSCRFGSPVFMSYPHFFNADPYYPDQVEGLSPNQKDHEFYMVVQPSTGIPLEVA 399
             .|..||::|:||||.|||.|:|.|||:||||...|.|.||||::.:|..::.:.|.||:|:.|:
Zfish   320 -PCRQSGLLNVSSCRHGSPTFISQPHFYNADPQLLDTVSGLSPSEDEHGLFIDIHPETGVPVNVS 383

  Fly   400 ARFQVNMLVEPIQGISLYTGIPRIFFPLVWFEQKVRITPDM----ADQLKVLPIVM-LSGHIF-- 457
            .|.|:|:.::.:.|||....|..:..|::|||:...|...:    ...|.|||.|| ...:||  
Zfish   384 VRLQLNLFLKKVSGISETGNIAEVVMPMLWFEESGYIDGPVLHTFRTNLVVLPKVMEYMQYIFIA 448

  Fly   458 AGICLIVGITLLCWTPVQILLASCRNRRYDLRTKTKTNGQYKSRSQFSSAEELKSKAS 515
            .|:..|:...:|..|..::...|.:.....:.|:...|..:..:...:..:..|...|
Zfish   449 LGLAAILTAVILFLTDKKVWKKSSQTLTQAVSTRVYDNVNHSKQHPANETQAEKYNQS 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 143/465 (31%)
scarb1XP_017213428.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 1 0.910 0.609 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.