DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: santa-maria and CG7227

Sequence 1:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001245934.1 Gene:CG7227 FlyBaseID:FBgn0031970 Length:518 Species:Drosophila melanogaster

Alignment Length:530 Identity:195/531 (37%)
Similarity:299/531 (56%) Gaps:29/531 (5%)


  Fly    21 IFGFCLGLFGILCGMFWVDLFDWIMHKEMALAPDTRVYENWKSPPIDLSLDIYLYNWTNPEDFGN 85
            :.|..|..|.:...::...:..|::...|.|.|.|.:...|:||.:|:::|:|::||||.|.|.:
  Fly    12 VLGLLLASFSLFSVLYMEQIERWMLEWFMVLRPGTMISSLWQSPAMDINVDLYIFNWTNSEKFSD 76

  Fly    86 LSTKPILEQVGPYRFIERPDKVDIHWHPENASVTYRRRSLFYFDAAGSNGSLDDEITTLNAVALS 150
            .:.||..|::|||||.||..||::.||.||::|:|||||.|.||...|.|...|.|...|.:.:.
  Fly    77 PTVKPRFEELGPYRFTERMQKVNVEWHDENSTVSYRRRSRFDFDPKLSVGRPTDPIVAPNLLIVG 141

  Fly   151 AAATAKYWPPVKRSLVDVGLKMYGAEMSVQKSIDELLFTGYNDAMIDVA-MAMPIFGDEVKVPFD 214
            .......|.|:.|||:.:.|.:||.|.::.:...:.:|.|::..||.:: |..|....|:|.|::
  Fly   142 LYQKMVMWSPMLRSLMLLALNIYGKEQAMIRPASDWMFDGFDTPMIKMSKMVPPSLVPEMKFPYE 206

  Fly   215 KFGWFYTRNGSADLTGVFNVFTGADQLAKLGQMHSWNYQENTGFFDSYCGMTNGSAGEFQPQHLK 279
            |.|:.|.||||.::.|..||:||.|:..||||:..|.| .|.......|.: .||||||.|..|.
  Fly   207 KIGYAYPRNGSMEIYGHHNVYTGRDEFQKLGQIARWRY-NNVTEASPRCKL-KGSAGEFHPIPLV 269

  Fly   280 PGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFSGGPRSVDNGTQYPENLCFCGGQC--VPSGV 342
            .|..:..|.||:||.:.:||..|...||::.:.:.|..|::.|||..|:|.|:|...|  |.||:
  Fly   270 KGRPISYFLPDLCRELQVDYSGTTIFEGIDAFVYRGSARNMANGTDNPDNSCYCQDNCQEVRSGL 334

  Fly   343 MNISSCRFGSPVFMSYPHFFNADPYYPDQVEGLSPNQKDHEFYMVVQPSTGIPLEVAARFQVNML 407
            :|||||.:|:|||.||||||.|||||.:||||:.|::..||..::::|.||:.||:.||...|:|
  Fly   335 LNISSCWYGTPVFASYPHFFKADPYYGEQVEGMKPDKDRHEMVIMLEPKTGMVLEIKARIMANLL 399

  Fly   408 VEPIQGISLYTGIPRIFFPLVWFEQKVRITPDMADQLKVLPIVMLSGHIFAGICLIVGITLLCWT 472
            |||...: :|....|.||||:|.:..||||.|:...:|::||:...|.|...:.:::|:.::.|.
  Fly   400 VEPKTHL-IYRTARRTFFPLIWADYNVRITDDLLVYVKLMPILEFVGKICGILGVVLGLLMVFWY 463

  Fly   473 PVQILLASCRNRRYDLRTKTKTNGQYKSRSQFSSAEELKSKASTLVCEKSVKGSPDSSPLLEKGR 537
            |.|::.......:.:: :..:||         ||.|.:|:            ...:.|||| ||.
  Fly   464 PHQMIWQKSLMHKIEI-SSIETN---------SSLEPVKN------------NDVEDSPLL-KGL 505

  Fly   538 KPTIIKSQTG 547
            :....|...|
  Fly   506 QYAAAKDGAG 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 180/454 (40%)
CG7227NP_001245934.1 CD36 13..463 CDD:279474 179/453 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49917448
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 1.030639 Normalized mean entropy S6187
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.