DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: santa-maria and pes

Sequence 1:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001137808.1 Gene:pes FlyBaseID:FBgn0031969 Length:555 Species:Drosophila melanogaster

Alignment Length:560 Identity:236/561 (42%)
Similarity:348/561 (62%) Gaps:30/561 (5%)


  Fly    16 KLIIGIFGFCLGLFGILCGMFWVDLFDWIMHKEMALAPDTRVYENWKSPPIDLSLDIYLYNWTNP 80
            :|.|.:.|.|....||.....|:|:|..:..:||||:|::|.:|.||..|:.|..||||:|||||
  Fly    10 RLGIVLLGICCIASGIYLFRNWIDMFTRMRGQEMALSPNSRSFEGWKVSPLPLDFDIYLFNWTNP 74

  Fly    81 EDF--GNLSTKPILEQVGPYRFIERPDKVDIHWHPENASVTYRRRSLFYFDAAGSNGSLDDEITT 143
            :||  |: :.||..||:|||||.|:||||||.||..||||::.::|.||||||||||||.|::||
  Fly    75 DDFYVGS-NKKPHFEQLGPYRFREKPDKVDIEWHNHNASVSFHKKSWFYFDAAGSNGSLWDKVTT 138

  Fly   144 LNAVALSAAATAKY-WPPVKRSLVDVGLKMYGAEMSVQKSIDELLFTGYNDAMIDVAMAMPIFGD 207
            :|:||.|||..|.. |  ..|:.|::..|:|...:::.|::||:||.||....|.|...:    .
  Fly   139 VNSVAHSAARRAAVDW--FARTGVNIANKLYRQGVTITKTVDEMLFKGYEHPFISVGKLL----R 197

  Fly   208 EVKVPFDKFGWFYTRNGSADLTGVFNVFTGADQLAKLGQMHSWNYQENTGFFDSYCGMTNGSAGE 272
            ...||:.:.|:.|.||||::..|..|:|||||.:||:||:|:||...:||.|:..||..:||.||
  Fly   198 PQDVPYKRIGYHYPRNGSSEFDGDINMFTGADDIAKMGQIHTWNNLTHTGAFEGTCGQVHGSMGE 262

  Fly   273 FQPQHLKPGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFSGGPRSVDNGTQYPENLCFC-GGQ 336
            |.|.:|...|:|.::.|.|||.|||||||||.:.|:..|||||...:|||||.||:..|:| ||:
  Fly   263 FFPPNLGTKDTVYMYMPKMCRAIPLDYVETVTVHGVTAYKFSGTRHAVDNGTLYPDTRCYCVGGK 327

  Fly   337 CVPSGVMNISSCRFGSPVFMSYPHFFNADPYYPDQVEGLSPNQKDHEFYMVVQPSTGIPLEVAAR 401
            |:||||:||..|.|.:.|:||:|||:.|||.|.:.:|||.|.::.|||:|.::|:.|:|::|...
  Fly   328 CMPSGVINIGPCSFNASVYMSFPHFYMADPSYLEAIEGLRPEREKHEFFMALEPNAGVPMDVGGG 392

  Fly   402 FQVNMLVEPIQGISLYTGIPRIFFPLVWFEQKVRITPDMADQLKVLPIVMLSGHIFAGICLIVGI 466
            ||.|..:|||.||:||..:|.:..|::|.|::||::.::|..:.::|:::|.|.|..||.|..|:
  Fly   393 FQANYYMEPIPGITLYENVPTVMIPMMWCEERVRVSEEIAADIALVPLIVLLGQIVTGILLAGGL 457

  Fly   467 TLLCWTPVQILLASCRNRRYDLRTKTKTNGQYKSRSQFSSAEELKSKASTLVCEKSVKGSPDSS- 530
            ...||.|.:.:...|.:   |.:.|...   .:..:.|.    :.|.|:|....:..:.:..|| 
  Fly   458 ICTCWYPTRQVTHFCHS---DPKAKASV---LRPLNAFG----VNSSAATAPVAQLFRNNISSSG 512

  Fly   531 ------PLLEKGRKPTI-IKSQTGESVATASTAISDNKQD 563
                  .||:..|...| ::|.|.|| :.....||::..|
  Fly   513 NERVGVRLLDYNRDSGIRLESGTMES-SHRERLISEDSPD 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 214/455 (47%)
pesNP_001137808.1 CD36 14..463 CDD:279474 213/456 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49917410
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.