DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: santa-maria and scarb2c

Sequence 1:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001352071.1 Gene:scarb2c ZFINID:ZDB-GENE-030131-5789 Length:478 Species:Danio rerio

Alignment Length:473 Identity:127/474 (27%)
Similarity:220/474 (46%) Gaps:46/474 (10%)


  Fly    25 CLGLFGILCGMFWV------------DLFDWIMHKEMALAPDTRVYENWKSPPIDLSLDIYLYNW 77
            |:...|.||.:..:            .|.:..:.:::.|...|..:..|::||..:.:..|.:|.
Zfish     7 CVSTAGALCVLLLICGIALELTRVLQKLVNNTVKQQIVLENGTEAFSVWQNPPPPVYMQFYFFNL 71

  Fly    78 TNPEDFGNLSTKPILEQVGPYRFIERPDKVDIHWHPENASVTYRRRSLFYFDAAGSNGSLDDEIT 142
            |||.:..: ..||.:.|:|||.:.|.....::.:......|.......:.|:...|.||.||.:.
Zfish    72 TNPAEVMS-GDKPSVVQIGPYTYREYRPMEEVKFMDNGTRVAAINPKTYVFEPNMSRGSQDDLVR 135

  Fly   143 TLNAVALSAAATAKYWPPVKRSLVDVGLKMYGAEMSVQKSIDELLFTGYNDAMIDVAMAMPIFGD 207
            |:|..|::  ...||...:...|:...:|..|..:.....:.:||: ||.|.::...        
Zfish   136 TVNIPAVT--VMEKYKDSILARLISDLMKAKGVGVFETFRVGDLLW-GYEDPLLKEL-------- 189

  Fly   208 EVKVPFDKFGWFYTRNGSADLTGVFNVFTGADQLAKLGQMHSWNYQENTGFFDS-YCGMTNGSAG 271
            .:.||.|.||.||.:||:.  ...:.:.||.........:..||.|.:..::.| .|.|.||:.|
Zfish   190 HMLVPDDHFGLFYKKNGTE--YDSYVLLTGKPDYQDFASIDEWNGQRSLNWWSSEECNMINGTDG 252

  Fly   272 -EFQPQHLKPGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFSGGPRSVDNGTQY-PENLCFC- 333
             .|.|...| .|.:.:|:.|:||::.:.|...|.::|:.|::|. .|..|.:.... |:|..|| 
Zfish   253 ASFHPIITK-ADRLYIFSSDLCRSLYVQYECDVSVQGVPGFRFV-PPADVFSSPDINPDNAGFCV 315

  Fly   334 -GGQCVPSGVMNISSCRFGSPVFMSYPHFFNADPYYPDQVEGLSPNQKDHEFYMVVQPSTGIPLE 397
             .|.|:.||::|.|.|:.|:|:.||.|||:.||..:.|.:.|:.|.:::|:.:..:.|.|||.|:
Zfish   316 PPGHCLGSGLLNASVCKQGAPIIMSSPHFYQADQKFVDDIWGMKPIKEEHQTFADINPLTGIVLQ 380

  Fly   398 VAARFQVNMLVEPIQGISLYTGIPRIFFPLVWFEQKVRITPDMADQLKV----------LPIVML 452
            .|.|.|||:.::.....|....|..:.||:::..:...|..:.|.:|..          :|.:::
Zfish   381 GAKRVQVNVYLQQHSSFSQTGKIQTLVFPVMYINESAFIDEESAKKLHAVVLNANVVINIPFIVI 445

  Fly   453 SGHIFAGICLIVGITLLC 470
            |..|..||..||   |:|
Zfish   446 SVGILLGIIFIV---LMC 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 127/474 (27%)
scarb2cNP_001352071.1 CD36 15..457 CDD:307331 121/458 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.