DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: santa-maria and crq

Sequence 1:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001245823.1 Gene:crq FlyBaseID:FBgn0015924 Length:491 Species:Drosophila melanogaster

Alignment Length:475 Identity:159/476 (33%)
Similarity:263/476 (55%) Gaps:28/476 (6%)


  Fly    12 KSNRKLIIGIFGFCLG----LFGILCGMFWVDLFDWIMHKEMALAPDTRVYENWKSPPIDLSLDI 72
            ::.||  :.:||  ||    |.|||..:||..:.|.::...:.|.|.|..||:|...||.:.|..
  Fly     8 ETQRK--VWVFG--LGSVFLLLGILIVVFWPGIADNLVEDGLTLKPGTDAYESWLEAPIPIYLSF 68

  Fly    73 YLYNWTNPEDFGNLSTKPILEQVGPYRFIERPDKVDIHWHPENASVTYRRRSLFYFDAAGSNGSL 137
            |::|||||||..|...||...::|||.|:|:..|.:..:: :||:|.|..|..::||...|||:|
  Fly    69 YMFNWTNPEDIRNPDIKPNFVEMGPYTFLEKHKKENYTFY-DNATVAYYERRTWFFDPERSNGTL 132

  Fly   138 DDEITTLNAVALSAAATAKYWPPVKRSLVDVGLKMYGAEMSVQKSIDELLFTGYNDAMIDVAMAM 202
            ||.:|..:|:..:.|...:....:.:.:::..|...|.::.|.|.:.|.:|.||.|.:.|.   :
  Fly   133 DDMVTAAHAITATVADEMRDQRKIVKKIINFMLNHEGGKLYVTKPVGEWIFEGYQDNITDF---L 194

  Fly   203 PIFG-DEVKVPFDKFGWFYTRNGSADLTGVFNVFTGADQLAKLGQMHSWNYQENTGFFDSYCGMT 266
            .:|. .::.:|:.:|||...||.|....|:|.:.||.|.::.||::..||.:..|||::..||:.
  Fly   195 NLFNTTKIDIPYKRFGWLADRNESLTYDGLFTIHTGTDDISNLGRLTHWNGKSETGFYEMPCGIV 259

  Fly   267 NGSAGEFQPQHLKPGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFSGGPRSVDNGTQYPENLC 331
            ||:.|:..|..:...|.:.:|..|.||.:.|....|.:..||...|:.|...::|:|..||...|
  Fly   260 NGTTGDMFPPKMNVNDEITIFATDACRFMNLRPRGTYENHGLTATKWVGTEETLDSGENYPNQAC 324

  Fly   332 FCG----GQCVPSGVMNISSCRFGSPVFMSYPHFFNADPYYPDQVEGLSPNQKDHEFYMVVQPST 392
            ||.    .:|..:||:...:||..:|::.|:|||:.||..|.|.|.|:.|.::.|||::.|:|.|
  Fly   325 FCDEARFDECPKTGVVECKACRDKAPIYSSFPHFYLADQSYVDAVSGMKPEKEKHEFFLAVEPIT 389

  Fly   393 GIPLEVAARFQVNMLVEPIQGISLYTGIPRIFFPLVWFEQKVRITPDMADQLKVLPIVMLSGH-- 455
            |:|::|..|.|:||::||.....:|.|:.::..|:.||:|...::.::|.:.|:  .:.||.:  
  Fly   390 GVPVQVHGRIQINMMIEPDDDFDIYRGVQKVLMPMFWFDQYAELSSELASKAKL--AINLSSYGI 452

  Fly   456 -------IFAGICLIVGITL 468
                   .||.:.||.||||
  Fly   453 IFGYSMIAFASVFLITGITL 472

Known Domains:


GeneSequenceDomainRegion External IDIdentity
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 156/465 (34%)
crqNP_001245823.1 CD36 19..470 CDD:307331 151/457 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49917586
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.