DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: santa-maria and ninaD

Sequence 1:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_724087.1 Gene:ninaD FlyBaseID:FBgn0002939 Length:513 Species:Drosophila melanogaster

Alignment Length:469 Identity:138/470 (29%)
Similarity:232/470 (49%) Gaps:30/470 (6%)


  Fly    19 IGIFGFCLGLFGILCGMFWVDLFDWIMHKEMALAPDTRVYENWKSPPIDLSLDIYLYNWTNPEDF 83
            :|.|....||..|:|   |....|..:.|.:.|.|.::.:|.|:..||.:.:.:||:||||..|.
  Fly    18 LGTFFAVSGLLAIIC---WPGFIDSGIMKALPLTPTSKTFEKWEELPIPVYVYMYLWNWTNAADV 79

  Fly    84 GNLSTKPILEQVGPYRFIERPDKVDIHWHPENASVTYRRRSLFYFDAAGSNGSLDDEITTLNAVA 148
            .....|||..|:|||.:.|...|:|:.|| :|.:||:..|..::::...|.|...|.||..:..:
  Fly    80 QANGVKPIFAQLGPYVYREERKKMDLEWH-DNGTVTFNPRRTWFWEEELSGGKQTDLITAPHLPS 143

  Fly   149 LSAAATAKYWPPVKRSLVDVGLKMYGAEMSVQKSIDELLFTGYNDAMIDVAMAM--PIFGDEVKV 211
            |:|:...:......:.:.:..|...|..:.|..:..|.||..:.|..:..||.:  |:.   .|:
  Fly   144 LAASNQMRNSNVFLKFMFNEALNANGGHLFVTHTAAEWLFESFYDEFLHYAMTLNNPLV---PKI 205

  Fly   212 PFDKFGWFYTRNGSADLTGVFNVFTGADQLAKLGQMHSWNYQENTGFFDSYCGMTNGSAGE-FQP 275
            ..|.|.||..||||.|..|.|.|.||...:.::|::..|..|.:||::|..||..|||..: |.|
  Fly   206 ESDHFAWFLNRNGSKDFEGPFTVHTGVGDIKEMGEIKYWKGQNHTGWYDGECGRLNGSTTDLFVP 270

  Fly   276 QHLKPGDSVGLFTPDMCRTIPLDYV-ETVDIEGLEGYKFSGGPRSVDNGTQYPENLCFC-----G 334
            ...|. .::.:|.||.||.|.|::. ::..|:|:.|:|:...|.:.|||.......|:|     .
  Fly   271 DEPKE-KALTIFIPDTCRIINLEFTGQSETIQGITGWKYEITPNTFDNGQINGNAKCWCPLERQP 334

  Fly   335 GQCVPSGVMNISSCRFGSPVFMSYPHFFNADPYYPDQVEGLSPNQKDHEFYMVVQPSTGIPLEVA 399
            ..|..:|..::..|..|.|:::|..||..||..|...:.|.:||...:.||::::...|:||:|.
  Fly   335 DNCPATGATDLGPCADGVPMYLSADHFMYADESYGSTISGYNPNYDQNNFYIIMERKMGVPLKVN 399

  Fly   400 ARFQVNMLVEPIQGISLYTGIPRIFFPLVWFEQKVRITPDMADQLKV---LPIVMLSGHIFAGI- 460
            |...:.:.:||...|.:..|:|..:.||.....:..|...:|.:|::   ||.:   |. :.|: 
  Fly   400 ANVMITLYIEPDSVIDILKGLPSFYAPLFTTASRAEIDEALASELRLALNLPAI---GR-YTGVG 460

  Fly   461 -----CLIVGITLL 469
                 |:::.:.:|
  Fly   461 FLCLGCILIAVGIL 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 136/466 (29%)
ninaDNP_724087.1 CD36 19..474 CDD:279474 137/467 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49917655
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.