DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: santa-maria and Scarb1

Sequence 1:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_113729.1 Gene:Scarb1 RGDID:2302 Length:509 Species:Rattus norvegicus

Alignment Length:542 Identity:158/543 (29%)
Similarity:252/543 (46%) Gaps:74/543 (14%)


  Fly    26 LGLFGILCGMFWV-------DLFDWIMHKEMALAPDTRVYENWKSPPIDLSLDIYLYNWTNPEDF 83
            ||:.|:||....|       .|....:.|.:.:.|.:..:..||..|:...|.:|.:...||.:.
  Rat    14 LGVLGLLCAALGVIMILMVPSLIKQQVLKNVRIDPSSLSFGMWKEIPVPFYLSVYFFEVVNPSEV 78

  Fly    84 GNLSTKPILEQVGPYRFIERPDKVDIHWHPENASVTYRRRSLFYFDAAGSNGSLDDEITTLNAVA 148
            .| ..||::.:.|||.:.|...||:|.:: :|.:|:|.......|....|.||..|.|...|.:.
  Rat    79 LN-GQKPVVRERGPYVYREFRQKVNITFN-DNDTVSYIENRSLRFQPDRSQGSESDYIVLPNILV 141

  Fly   149 LSAAATAKYWPPVKRSLVDVGLKMYGAEMSVQKSIDELLFTGYNDAMIDVAM-----AMPIFGDE 208
            |..|...:..|...:.|:.:||...|....:.:::.|:|: ||.|..::...     ..||.|  
  Rat   142 LGGAVMMEDKPTSLKLLMTLGLVTMGQRAFMNRTVGEILW-GYEDPFVNFLSKYFPDMFPIKG-- 203

  Fly   209 VKVPFDKFGWFYTRNGSADLTGVFNVFTGADQLAKLGQMHSWNYQENTGFFDS-YCGMTNGSAGE 272
                  |||.|...|.|:  :|||.||||....:|:..:..||......::.| .|.|.||:||:
  Rat   204 ------KFGLFVGMNDSS--SGVFTVFTGVQNFSKIHLVDKWNGLSEVNYWHSEQCNMINGTAGQ 260

  Fly   273 FQPQHLKPGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFSGGPRSVDNGTQYPENLCFCGGQC 337
            .....:.|..|:..|:|:.||::.|.|.|:...||:..|:|:.......||:.||.|..||  .|
  Rat   261 MWAPFMTPESSLEFFSPEACRSMKLTYQESRVFEGIPTYRFTAPDTLFANGSVYPPNEGFC--PC 323

  Fly   338 VPSGVMNISSCRFGSPVFMSYPHFFNADPYYPDQVEGLSPNQKDHEFYMVVQPSTGIPLEVAARF 402
            ..||:.|:|:||||:|:|:|.|||:||||...:.|.||:|:.|:|..::.:.|.||||:..:.:.
  Rat   324 RESGIQNVSTCRFGAPLFLSQPHFYNADPVLSEAVLGLNPDPKEHSLFLDIHPVTGIPMNCSVKM 388

  Fly   403 QVNMLVEPIQGISLYTGIPRIFFPLVWFEQK----VRITPDMADQLKVLPIVMLSGHIFAGICLI 463
            |:::.::.::|:.....|..:..||:||||.    .:.......||.::|.|:   |....:.|.
  Rat   389 QLSLYIKSVKGVGQTGKIEPVVLPLLWFEQSGMMGGKTLNTFYTQLVLMPQVL---HYAQYVLLG 450

  Fly   464 VGITLLCWTPVQILLASCRNRRYDLRTKTKTNGQYKSRSQFSSAEELKSKASTLVCEKSVKGSPD 528
            :|..||.   |.|:        |.||::.|                     ..|....|.|||.|
  Rat   451 LGGLLLL---VPII--------YQLRSQEK---------------------CFLFWSGSKKGSQD 483

  Fly   529 -------SSPLLEKGRKPTIIK 543
                   |..|:....|.|:::
  Rat   484 KEAMQAYSESLMSPAAKGTVLQ 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 142/465 (31%)
Scarb1NP_113729.1 CD36 21..447 CDD:279474 134/444 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 1 0.910 0.611 Consistency score
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.