DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: santa-maria and scarb2a

Sequence 1:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_775366.1 Gene:scarb2a ZFINID:ZDB-GENE-020419-29 Length:531 Species:Danio rerio

Alignment Length:517 Identity:130/518 (25%)
Similarity:247/518 (48%) Gaps:30/518 (6%)


  Fly    17 LIIGIFGFCLGLFGILCGMFWVDLFDWIMHKEMALAPDTRVYENWKSPPIDLSLDIYLYNWTNPE 81
            ||:||        .:|....:..:....:.||:.||.::||.:.|.:||..:.:..:.:|.|||:
Zfish    19 LILGI--------ALLLAQVFQTMIQERIKKEITLAENSRVLDGWINPPPPVYMQYFFFNVTNPD 75

  Fly    82 DFGNLSTKPILEQVGPYRFIERPDKVDIHWHPENASVTYRRRSLFYFDAAGSNGSLD-DEITTLN 145
            :|.....|..:.|:|||.:.|...:.::.:......:.......|.|....|.|..: |.:||:|
Zfish    76 EFLAGKEKAKVTQMGPYTYREYRPRENVTYLENGTKIFATNPKSFVFLRNMSAGDPEVDRVTTVN 140

  Fly   146 AVALSAAATAKYWPPVKRSLVDVGLKMYGAEMSVQKSIDELLFTGYNDAMIDVAMAMPIFGDEVK 210
            ...::.......:....|:.|.:.:...|..:.:.:::.|:|: |:.|.::....||....||  
Zfish   141 IPMIAVMNELNSYSFFVRTAVSMYMGSMGMGLFMNRTVHEILW-GFKDPLLTKLHAMRPEVDE-- 202

  Fly   211 VPFDKFGWFYTRNGSADLTGVFNVFTGADQLAKLGQMHSWNYQENTGFFDS-YCGMTNGSAGEFQ 274
                .||..|.:||:.:  |.|...||.......|::.:||......::.| ...|.||:.|...
Zfish   203 ----HFGLMYNKNGTHE--GEFVFHTGEKNYMNYGKIDTWNGISQMNWWSSNQSNMINGTDGSVF 261

  Fly   275 PQHLKPGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFSGGPRSVDNGTQYPENLCFC--GGQC 337
            ...|...:.:.:|..|:||:|.|.||..::::|:..::|:.....:....:.|.|..||  .|.|
Zfish   262 HTFLSRKELLYIFAADLCRSIHLGYVRDMEVKGIPAFRFAPPSDVLAPPDENPANAGFCVPAGDC 326

  Fly   338 VPSGVMNISSCRFGSPVFMSYPHFFNADPYYPDQVEGLSPNQKDHEFYMVVQPSTGIPLEVAARF 402
            :..||:.:|.||.|:|:.:|:|||:.||..|.:.:||::||:::||.|:.:.|:||:|:....|.
Zfish   327 LGKGVLKVSVCRQGAPIVVSFPHFYQADERYINAIEGMNPNEEEHETYLDINPTTGVPIRACKRA 391

  Fly   403 QVNMLVEPIQGISLYTGIPRIFFPLVWFEQKVRITPDMADQLKVLPIVMLSGHIFAGICLIVGIT 467
            |:|::::.::|......:....||:::..:...|..:.|.|:::|.:::.....|..|.|.:|:.
Zfish   392 QLNIILKRVRGFPNTKFLNETIFPIMYVNETATIDDESAAQMRMLLLIVTVVSNFPVIILALGVI 456

  Fly   468 LLCWTPVQILLASCRNRRYDLRTKTKTNGQYKSRSQFSSAEELKSKASTLVCEKSVKGSPDS 529
            ||    |.::...||||:.....|     :......|.|....|.:.:........:.||::
Zfish   457 LL----VVLIFLVCRNRQRKNEVK-----RIDFTEAFHSFATTKDETAYTQVSNQAEDSPEN 509

Known Domains:


GeneSequenceDomainRegion External IDIdentity
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 115/455 (25%)
scarb2aNP_775366.1 CD36 30..463 CDD:279474 115/446 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.