DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: santa-maria and scav-5

Sequence 1:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_509651.2 Gene:scav-5 WormBaseID:WBGene00011076 Length:536 Species:Caenorhabditis elegans

Alignment Length:539 Identity:134/540 (25%)
Similarity:217/540 (40%) Gaps:114/540 (21%)


  Fly    21 IFGFCLGLFGILCGM-----FWVDLFDWIMHKEMALAPD--------TRVYENWKSPPIDLSLDI 72
            |..|.:..|..|.|:     || .:|:..:.....|..:        ..:|.|   ||:...:..
 Worm     9 IISFVIAAFFFLSGLSMWIAFW-PIFNSELRSNYKLGANDDGSLHYAAFLYAN---PPMKNVMKF 69

  Fly    73 YLYNWTNPEDFGNLSTKPILEQVGPYRFIERPDKVDIHWHPENASVTYRRRSLFYF----DAAGS 133
            .|:|.|||::...|..||.|.:||.|.|:|...|....:..:...:.|:....:::    :.||.
 Worm    70 NLFNVTNPDEVKYLGAKPELIEVGGYAFLESEQKKYYEFSSDKTKMFYQNYKQYHYSEVDNDAGY 134

  Fly   134 NGSLDDEITTLNAVALSAAATA----KYWPPVKRSLVDVGLKMYGAEMSVQKSIDELLFTGYNDA 194
            |  .:|:|...|::|..|.:|.    ..:.|..:.||.:||.|.|....:.|::.::|..||.|.
 Worm   135 N--YNDKIMFPNSIAEGAVSTVFGPQSEFSPTAKILVSIGLVMLGEYPFISKTVKDVLMDGYEDP 197

  Fly   195 MIDVAMAMPIF---------GDEVK-VPFDK-FGWFYTRNGSADLTGVFNVFTGADQLAKLGQMH 248
            ::.||.: .||         |.::. :|..| |.:....|.|.|.....|  ||.:...|||.:.
 Worm   198 LLSVAHS-GIFISLVNFYGYGSQLNYIPEMKTFAYLSGYNNSYDENYWIN--TGYNDFNKLGFVE 259

  Fly   249 SWNYQEN--TGFFDS-----YCGMTNGSAGEFQPQHLKPGDSVGLFTPDMCRTIPLDYVETVDIE 306
            ||...|.  ..|:.:     ..|..:||..:.   ||...|.:..|...|||:....|.:...::
 Worm   260 SWAGLEQLPASFWPTLEARQIKGPDSGSLSKI---HLTKTDELPFFLSFMCRSFKRTYWQDGLVD 321

  Fly   307 GLEGYKFSGGPRSVDN------GTQY--PENLCFCGGQCVPSGVMNISSCR------FGSP---- 353
            |::...|:......|.      |.:|  .||:.:....|..:...::|.|:      |..|    
 Worm   322 GIKTMAFAVPYEEFDTTLEKNAGFRYKNQENVDYFPDWCDKNTTTSLSQCQKTANGTFLLPPGIF 386

  Fly   354 ---------------VFMSYPHFFNADPYYPDQVEGLSPNQKDHEFYMVVQPST-GIPLEVAARF 402
                           |.:|.|||..:.|.....:.|::|:.:.|:..:..|..| |..|:|..||
 Worm   387 PLVCYPGHNAQPPFTVLVSPPHFLYSPPEVQHHLSGMNPDPEKHKPMVFHQEKTSGTALQVDVRF 451

  Fly   403 QVNMLVEPIQGISLYTGIPRIFFPL----------------VWFEQKVRITPDMADQLK-VLPIV 450
            |||:.|...:|..:.:.:|.:..||                ||.  .|.|.|.:.:.|| ||   
 Worm   452 QVNLPVVNNKGSIMSSQMPNVIIPLFYEDSHALVKDFVMDTVWL--GVIIVPRIIEYLKFVL--- 511

  Fly   451 MLSGHIFAGICLIVGITLL 469
                 ||..||::.  |||
 Worm   512 -----IFISICILT--TLL 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 133/538 (25%)
scav-5NP_509651.2 CD36 15..524 CDD:279474 132/534 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T97988
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.