DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: santa-maria and scav-1

Sequence 1:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_508919.2 Gene:scav-1 WormBaseID:WBGene00015389 Length:563 Species:Caenorhabditis elegans

Alignment Length:554 Identity:129/555 (23%)
Similarity:226/555 (41%) Gaps:112/555 (20%)


  Fly    24 FCLGLFGILCGMFWV-DLFDWIMHKEMALAPDTRVY------------ENWKSPPIDLSLDIYLY 75
            |.:|...::.|:..| ::|..|::.::   .|::|.            ::|.:.....::..::|
 Worm    16 FLIGAALLVAGLVIVLNVFPNIVNNQI---NDSKVLGLNADGTLNSFTDSWVNSKYISTMQYWVY 77

  Fly    76 NWTNPEDFGNLSTKPILEQVGPYRFIE--RPDKVDIHWHPENAS-VTYRRRSLFYFDAAGSNGSL 137
            ::||.....|.:..|.:.:.|||.|.|  ..||::.   .||.. :.:|:...|.|:...|....
 Worm    78 DYTNTIGIMNRAIYPDVREKGPYAFDEILTMDKLNF---SENGEFMEFRQIQTFVFNPNKSCAGC 139

  Fly   138 D-----------------DEITTL------NAVALSAA-ATAKYWPPVKRSLVDVG--------- 169
            |                 |:|.|:      |.:|.:.. |..|..|...::..::|         
 Worm   140 DPYKDKVLIPDMGFQVGIDQIDTVIEGILKNPLAATICHAIMKGKPNANQTCSNLGALIEGELGT 204

  Fly   170 -LKMYGAEMSVQKSIDELLFTGYN----DAMIDVAMAMP--IFGDEVKVPFDKFGWFYTRNGSAD 227
             :.::........::|:|||:||.    :..:|.|:.|.  :||...|...|........||::|
 Worm   205 LISLFNVSPFTTVTVDQLLFSGYKTPFVEKFLDEALGMLHFLFGTAPKPLDDPPIQLNPLNGTSD 269

  Fly   228 LTGVFNVFTGADQLAKLGQMHSWNYQENTGFFDS----------------YCGMTN------GSA 270
            :  :..|.||.....|.|.|..:....|...|:|                ||...|      |:.
 Worm   270 I--INTVLTGKTDPLKAGYMTEFRSISNNSLFNSIGNTLPPMWWPYANKTYCKDPNSALVLTGTN 332

  Fly   271 GEFQPQHLKPGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFSGGPRSVDNGTQYPENLCFC-- 333
            |::....:|..|.:..|..|:||||...:...|.::|.:||:|...|...|....  ||..:|  
 Worm   333 GDYFKNFVKKTDILPAFVSDVCRTIHFVFDREVTVKGFKGYRFVMPPTQFDYSLD--ENCGYCIP 395

  Fly   334 ----------GGQCVPSGVMNISSCRFGSPVFMSYPHFFNADPYYPDQVEGLSPNQKDHEFYMVV 388
                      ...|:|||:::||.|. |.|:.||.|||:.|.......|....|...:.|..:.:
 Worm   396 LKYGSYEYPAQSACLPSGLLDISQCT-GGPIIMSKPHFYQASKVVSKFVPRFKPTYDNDETMLDI 459

  Fly   389 QPSTGIPLEVAARFQVNMLVEPIQGISLYTGIPRIFFPLVWFEQKVRITPDMADQLK---VLPIV 450
            :|:||..|:...|.|:||||...:.|..|:.:....:||.|..:...:..:..|||.   ..|:.
 Worm   460 EPNTGTVLQAQKRLQINMLVNQFKHIRSYSVMRPGAYPLAWVNESFYMDQNTIDQLNSQLFTPVS 524

  Fly   451 MLSGHIFAGICLI---VGITLLCWTPVQILLASC 481
            .::     .||.|   :|..|:..:.|.::::.|
 Worm   525 TVN-----TICWIAVGLGAGLIALSIVMVIVSFC 553

Known Domains:


GeneSequenceDomainRegion External IDIdentity
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 127/546 (23%)
scav-1NP_508919.2 CD36 19..546 CDD:279474 126/543 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 1.030639 Normalized mean entropy S6187
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 1 1.000 T98012
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 1 0.910 0.618 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.