DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment santa-maria and scav-2

DIOPT Version :10

Sequence 1:NP_609121.2 Gene:santa-maria / 34024 FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_499802.3 Gene:scav-2 / 176787 WormBaseID:WBGene00013578 Length:558 Species:Caenorhabditis elegans


Alignment Length:30 Identity:12/30 - (40%)
Similarity:16/30 - (53%) Gaps:6/30 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 WRVLELSDIVLIIVDARFPTLMFPPALYKY 204
            || |:.:.|.|:|| |.|    |.|..|.:
 Worm    91 WR-LDYAGISLMIV-ASF----FAPIYYAF 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
santa-mariaNP_609121.2 CD36 21..476 CDD:460076 12/30 (40%)
scav-2NP_499802.3 CD36 42..505 CDD:460076 12/30 (40%)

Return to query results.
Submit another query.