DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: santa-maria and scav-2

Sequence 1:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_499802.3 Gene:scav-2 WormBaseID:WBGene00013578 Length:558 Species:Caenorhabditis elegans

Alignment Length:559 Identity:123/560 (22%)
Similarity:222/560 (40%) Gaps:137/560 (24%)


  Fly     1 MPTQNSAMWGQKSNRKL----------------------IIGIFGFCLGLFGILCGMFWVDLFDW 43
            ||:.|::..|..|:..:                      :||:..|.  |||.|           
 Worm     1 MPSSNNSSNGASSSSPIASKYSSGRMRRMSCCQLVISAVLIGLGSFL--LFGSL----------- 52

  Fly    44 IMH-------------KEMALAPDTRVYENWKSPPIDLSLDIYLYNWTNPEDFGNLSTKPILEQV 95
            |.|             :...|...:.::|.|..|...:..::|:|:..||::|.| ...|.:...
 Worm    53 ITHTVVVPKVVKSSIEENSRLVNGSIMWEKWAMPEYKIRFNMYVYSTKNPDEFMN-GAIPEVTGS 116

  Fly    96 GPYRFIERPDKVDIHWHPENASVTYRRRSLFYFDAAGSNGS--LDDEITTLNAV---ALSAAATA 155
            |||.|.::.:...:  ..||.:|.|||...:.|:...|..:  |.:.|...|.:   .:.||:|.
 Worm   117 GPYVFDKKMENRVV--SAENGTVKYRRFFTYNFNEQESCQTCILGNRIWVPNMIYQKFVEAASTE 179

  Fly   156 KYWPPVKRSLVDVGLKMYGAEMSVQKS-----IDELLFTGYNDAMIDVAMAMPI--FGDE--VKV 211
                         |:|.....:..|.:     ::||||.||.|..:|....:|.  |..|  :.|
 Worm   180 -------------GMKAAATTLLSQTAFLEVEVEELLFEGYKDPFLDKVCEIPFMNFVCEAILDV 231

  Fly   212 PFDKFGWFYTRNGSADLTGVFNVFTGADQLAKLGQMHSWNYQENTGFFDSYCGM--------TNG 268
            | ::.|.|:..||:.  :.|:.:..|......||::.|  |.|:....:::...        |:|
 Worm   232 P-ERIGLFFKANGTG--SKVYEIDDGTRNPDDLGKILS--YDESPILDETWWSTDESLKIKGTDG 291

  Fly   269 SAGEFQPQHLKPGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFSGGPRSVDNGTQYPENLCFC 333
            |.  |.| .|...:.:.::..::||:|.|::.|.|:..||:.|:|...|...|  ..:|.|..||
 Worm   292 SL--FHP-FLSKHEKLYVYVAELCRSIWLEFKEEVEYRGLKAYRFVVPPEVFD--VTHPGNQGFC 351

  Fly   334 -------------GGQCVPSGVMNISSCRFGS-PVFMSYPHFFNADPYYPDQVEGLSPNQKDHEF 384
                         ...|:|.|::.||.|:... |:.:|.|:|..|.......|:||:...:..:.
 Worm   352 NPSEKQFYESQNDSSNCMPKGLLEISKCQQSQPPITISLPNFLFAPSEVRGSVKGLNETDEIRDS 416

  Fly   385 YMV-VQPSTGIPLEVAARFQVNMLVEPIQGISLYTGIPRI---FFPLVWFEQKVRITPDMADQLK 445
            .:| ::|..|..|......|||:.:...:.::....:.::   ..|::...:...|..|..:|::
 Worm   417 IVVDIEPRVGAVLYARRVSQVNIEMWKGKNLTFPVNLKKMKSALIPVLILHETSEIDDDSLEQIR 481

  Fly   446 -------------------VLPIVMLSGHIF----AGIC 461
                               :..|::|.|.:|    .|:|
 Worm   482 SQLYETESIAYTSCDVMMIIGAIMLLLGFLFLSFSLGLC 520

Known Domains:


GeneSequenceDomainRegion External IDIdentity
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 116/516 (22%)
scav-2NP_499802.3 CD36 46..505 CDD:279474 111/498 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I2712
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 1 1.000 T98012
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 1 0.910 0.621 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.