DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: santa-maria and scav-3

Sequence 1:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_499625.2 Gene:scav-3 WormBaseID:WBGene00013039 Length:534 Species:Caenorhabditis elegans

Alignment Length:456 Identity:120/457 (26%)
Similarity:217/457 (47%) Gaps:53/457 (12%)


  Fly    59 ENWKSPPIDLSLDIYLYNWTNPEDFGNLSTKPILEQVGPYRFIERPDKVDIHWHPENASVTYRRR 123
            ::|..|...:.|:|:::|.||.:.......||.|.::||:.|.|..:||...:...:..|.|:.:
 Worm    63 KSWLKPLYAMQLNIWMFNVTNVDGILKRHEKPNLHEIGPFVFDEVQEKVYHRFADNDTRVFYKNQ 127

  Fly   124 SLFYFDAAGSNGS-----LDDEITTLNAV---ALSAAATAKYWPPVKRSLVDVGLKMYGAEMSVQ 180
            .|::|:   .|.|     ||.::|..|.|   .:.||....:...:|.::..| |||......:.
 Worm   128 KLYHFN---KNASCPTCHLDMKVTIPNIVFQKLIDAADVTIFGVRIKFAIESV-LKMVSEAPYIT 188

  Fly   181 KSIDELLFTGYNDAMIDVAMAMPI--FGDEVKVPFDKFGWFYTRNGSADLTGVFNVFTGADQLAK 243
            ..:.:.||.||.|.:||:.....|  |..|......:.|:||.:||:.|  |::.|..|....:|
 Worm   189 VKVSDALFDGYEDPIIDIVCKNKILQFLCETNSLQRRVGFFYGQNGTTD--GIYEVDAGVPSPSK 251

  Fly   244 LGQMHSWNYQEN--TGFFDS-YCGMTNGSAGEFQPQHLKPGDSVGLFTPDMCRTIPLDYVETVDI 305
            :|.:::||....  .|.:|: |..|.||:.|:.....||..|.:.:|.|.:||:|.::|.:.|.:
 Worm   252 IGHLYTWNNMTEMPEGTWDTKYARMINGTDGQLFSPMLKREDRLTIFVPQICRSIQMEYTKDVAV 316

  Fly   306 EGLEGYKF--------------------SGGPRSVDNGTQYPENLCFCGGQCVPSGVMNISSCRF 350
            .|:..:::                    :|.||..||.|...||       |:|:|::::|.|:.
 Worm   317 NGVPSWRYAPPLDLYDPALPQNRAFCNKNGMPRYFDNTTVQIEN-------CLPAGLIDLSRCQA 374

  Fly   351 GSP-VFMSYPHFFNADPYYPDQVEGLSPNQKDHEFYMV-VQPSTGIPLEVAARFQVNMLVEPIQG 413
            |:| |::|.|||:|:.......|.|||.....::..:| ::|:.|:|.:.....|:|  |..::|
 Worm   375 GNPRVYLSNPHFYNSPMELWHSVTGLSVPTASNDLTVVDIEPTAGVPTQAKRIMQIN--VGMVKG 437

  Fly   414 -ISLYTGIPRIFFPLVWFEQKVRITPDMADQLKVLPIVMLSGHIFAGICLIVGITLLCWTPVQIL 477
             :|:......:..|::|..:.........|||  :.|.....:.|.|..:.:.:.|:.|..|.::
 Worm   438 SLSVTENTTNVVVPVLWMNETAYFDQGTRDQL--INIFNAKHYSFIGGVISLSLGLIAWLAVFVV 500

  Fly   478 L 478
            :
 Worm   501 I 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 119/451 (26%)
scav-3NP_499625.2 CD36 52..499 CDD:279474 120/453 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I2712
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 1 1.000 T98012
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 1 0.910 0.650 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.