DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: santa-maria and Scarb2

Sequence 1:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_446453.1 Gene:Scarb2 RGDID:621882 Length:478 Species:Rattus norvegicus

Alignment Length:460 Identity:130/461 (28%)
Similarity:232/461 (50%) Gaps:49/461 (11%)


  Fly    42 DWIMHKEMALAPDTRVYENWKSPPIDLSLDIYLYNWTNPEDF--GNLSTKPILEQVGPYRFIERP 104
            |..:.|.|.|...|:|:::|:.||:.:.:..|.:|.||||:.  |.:   |:||:||||.:.|..
  Rat    34 DQTIEKNMVLQNGTKVFDSWEKPPLPVYIQFYFFNVTNPEEILQGEI---PLLEEVGPYTYRELR 95

  Fly   105 DKVDIHWHPENASVTYRRRSLFYFDAAGSNGS-LDDEITTLNAVALSAAATAKYWPPVKRSLVDV 168
            :|.::.:.....:::......:.|:...|.|. ..|.|.|:|...|:....|:  .|..|.:::.
  Rat    96 NKANVQFGENGTTISAVTNKAYIFERNQSVGDPTVDLIRTINIPLLTVVEMAQ--QPFLREIIEA 158

  Fly   169 GLKMYGAEMSVQKSIDELLFTGYNDAMIDVAMAMPIFGDEVKVPFDKFGWFYTRNGSADLTGVFN 233
            .||.|...:.|..::.|||: ||.|   :|...:.||..:|.   ..||.||.|||:.|  |.:.
  Rat   159 MLKAYQQTLFVTHTVHELLW-GYKD---EVLSLVHIFRPDVS---PNFGLFYERNGTND--GEYV 214

  Fly   234 VFTGADQLAKLGQMHSWNYQENTGFFDS-YCGMTNGSAGE-FQPQHLKPGDSVGLFTPDMCRTIP 296
            ..||.|......::..||.:.:..::.: .|.|.||:.|: |.|. :...:::.:|..|.||::.
  Rat   215 FLTGEDNYLNFTKIVEWNGKTSLDWWTTDTCNMINGTDGDSFHPL-ISKDETLYIFPSDFCRSVY 278

  Fly   297 LDYVETVDIEGLEGYKFSGGPRSVDNGTQYPENLCFC--GGQCVPSGVMNISSCRFGSPVFMSYP 359
            :.:....::|||..:::......:.|.:   ||..||  .|.|:.:||:|:|.|:.|:|:.||:|
  Rat   279 ITFSSFENVEGLPAFRYKVPAEILANSS---ENAGFCIPEGNCMDAGVLNVSICKNGAPIIMSFP 340

  Fly   360 HFFNADPYYPDQVEGLSPNQKDHEFYMVVQPSTGIPLEVAARFQVNMLVEPIQGISLYTGIPRIF 424
            ||:.||..:...::|:.||:::||.::.:.|.|||.|..|.|||:|..|:.:........|..:.
  Rat   341 HFYQADEKFVSAIKGMRPNKEEHESFVDINPLTGIILRGAKRFQINTYVKKLDDFVETGNIRTMV 405

  Fly   425 FPLVWFEQKVRITPDMADQLKV----------LPIVMLSGHIFAGICLIVGITLLCWTPVQILLA 479
            ||:::..:.|.|..:.|.|||.          :|.::::..:|.|:       :..|       .
  Rat   406 FPVMYLNESVLIDKETASQLKSVINTTLIVTNIPYIIMALGVFFGL-------IFTW-------L 456

  Fly   480 SCRNR 484
            :||.:
  Rat   457 ACRGQ 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 128/449 (29%)
Scarb2NP_446453.1 CD36 28..455 CDD:279474 127/446 (28%)
Important for interaction with GBA. {ECO:0000250} 155..191 12/40 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.