DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: santa-maria and scarb1

Sequence 1:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster
Sequence 2:XP_002935333.1 Gene:scarb1 XenbaseID:XB-GENE-494666 Length:505 Species:Xenopus tropicalis

Alignment Length:560 Identity:154/561 (27%)
Similarity:268/561 (48%) Gaps:91/561 (16%)


  Fly     8 MWGQKSNRKLIIGIFGFCLGLFGILCGMFWVDLFDWIMHKEMALAPDTR-VYENWKSPPIDLSLD 71
            |.|..:.:.::.|:.|..|...|.|.......:.|..:.|.:.:.|.:. .||.|:..|:...:.
 Frog     1 MAGVGNKKSIVFGVLGVLLVGVGTLLVFLVPVIMDEQVEKNVRIDPSSGFAYEMWRDLPVPFYMS 65

  Fly    72 IYLYNWTNPEDFGNLSTKPILEQVGPYRFIERPDKVDIHWHPENASVTYRRRSLFYFDAAGSNGS 136
            ||::...|.::. .|..||.|::.|||.:.|...|.:|.:: ||.:|::.....|:||...|||.
 Frog    66 IYIFEVVNHKEV-LLGEKPQLQERGPYVYREYKKKQNITFN-ENGTVSFVEFRTFHFDPEKSNGK 128

  Fly   137 LDDEITTLNAVALSAAATAKYWPPVKRSLVDVGLKM----------YGAEMSVQKSIDELLFTGY 191
            .:|.:...|.:.|.::.          .|.|:|:.:          :..|..:.|::.::|: ||
 Frog   129 EEDHVIVPNILVLGSSV----------MLQDLGIAIKWIISGAFSAFNEEAFINKTVKDILW-GY 182

  Fly   192 NDAMID-VAMAMPIFGDEVKVPF-DKFGWFYTRNGSADLTGVFNVFTGADQLAKLGQMHSWNYQE 254
            .|..:| :...:|     .|:|| .|||:|...|.|.  ||||.|.||.:.::::..:.:||..:
 Frog   183 EDPFLDFLNTFLP-----GKLPFKGKFGFFSDFNNSN--TGVFTVNTGMEDISRVQMVDNWNGLK 240

  Fly   255 NTGFFDS-YCGMTNGSAGEFQPQHLKPGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFSGGPR 318
            ...|::| ...|.||:||:..|...||.:.:..::||.||::.|.|.:.....|:..::::....
 Frog   241 KVDFWNSEQTNMINGTAGQMWPPFRKPSEPLEFYSPDACRSMKLVYEKEEKFRGIPTFRYTAPNY 305

  Fly   319 SVDNGTQYPENLCFCGGQCVPSGVMNISSCRFGSPVFMSYPHFFNADPYYPDQVEGLSPNQKDHE 383
            ...||:.||.|..||  .||.|||.|:|:|||.:|:|:|:|||:||||.:.:.||||.|.::.|.
 Frog   306 LFANGSDYPPNEGFC--PCVASGVQNVSACRFNAPLFLSFPHFYNADPGFLESVEGLHPTEELHS 368

  Fly   384 FYMVVQPSTGIPLEVAARFQVNMLVEPIQGISLYTG-IPRIFFPLVWFEQKVRITPDMADQLKVL 447
            .::.:.|.||||:..:.:.|:|||.:.:.|| :.|| |..:..|::||.:               
 Frog   369 LFLDMHPLTGIPMNCSIKMQLNMLTKSVSGI-MQTGQIKPVILPVLWFAE--------------- 417

  Fly   448 PIVMLSGHI-------FAGICLIVGITL-----------LCWTPVQILLASCRNRRYDLRTKTKT 494
                 |||:       :..|.:::.|.|           ||:..|.::|...:..:..|      
 Frog   418 -----SGHLDGPVYNTYYNILILMPIVLEYLQYVLIGIGLCFITVALVLPFVKQGKCFL------ 471

  Fly   495 NGQYKSRSQFSSAEELKSKASTLVCEKSVKGSPDSSPLLE 534
              .:.|......::|.|::...|.       :|:...|||
 Frog   472 --FWNSNKNVDESQEFKTQKEKLT-------APNGIVLLE 502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 140/484 (29%)
scarb1XP_002935333.1 CD36 29..460 CDD:279474 137/474 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.764 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.