DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: santa-maria and LOC100365047

Sequence 1:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster
Sequence 2:XP_017458226.1 Gene:LOC100365047 RGDID:2319823 Length:472 Species:Rattus norvegicus

Alignment Length:492 Identity:130/493 (26%)
Similarity:241/493 (49%) Gaps:45/493 (9%)


  Fly    10 GQKSNRKLIIG-IFGFCLGLFGILCGMFWVDLFDWIMHKEMALAPDTRVYENWKSPPIDLSLDIY 73
            |...|..||.| |.|..|.:||.:.......|.:..:.:|:.|...|..::||......:....:
  Rat     2 GCDQNCGLIAGAIIGAVLAVFGGILMPVGDLLIEKTIKREVVLEEGTIAFKNWVKTGTTVYRQFW 66

  Fly    74 LYNWTNPEDFGNLSTKPILEQVGPYRF-IERPDKVDIHWHPENASVTYRRRSLFYFDAAGSNGSL 137
            :::..||::....|:|..::|.|||.: :....|..|...|::::|::.:.:...|:.:.|.|:.
  Rat    67 IFDVQNPDEVAKNSSKIKVKQRGPYTYRVRYLAKESITQDPKDSTVSFVQPNGAIFEPSLSVGTE 131

  Fly   138 DDEITTLNAVALSAAATAKYWPPVKRSLVDVGLKMYGAEMSVQKSIDELLFTGYNDAMIDVAMAM 202
            :|..|.||...  ||....|.....:.::::.:|...:.|...:|:.|||: ||.|..:.:    
  Rat   132 NDNFTVLNLAV--AAVPHIYQNSFFQGVLNIFIKKSKSSMFQTRSLKELLW-GYEDPFLSL---- 189

  Fly   203 PIFGDEVKVPF---DKFGWFYTRNGSADLTGVFNVFTGADQLAKLGQMHSWNYQENTGFFDSYCG 264
                    :|:   ...|.||..|.:.|  ||:.||.|.|.::|:..:.::..:.|..::.|||.
  Rat   190 --------IPYPISTTVGVFYPYNNTVD--GVYKVFNGKDNISKVAIIDTYKGKRNLSYWKSYCD 244

  Fly   265 MTNGSAGEFQPQHLKPGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFSGGPRSVDNGTQYPEN 329
            |.||:.....|..::...::..|:.|:||:|...:...|:::|:..|:|.....:..:..|.|:|
  Rat   245 MINGTDAASFPPFVEKSQTLRFFSSDICRSIYAVFESEVNLKGIPVYRFVLPANAFASPLQNPDN 309

  Fly   330 LCFC-----GGQCVPSGVMNISSCRFGSPVFMSYPHFFNADPYYPDQVEGLSPNQKDHEFYMVVQ 389
            .|||     ...|...||::|..|:.|.||::|.|||.:|.|...:.:|||:||:.:|..|:.|:
  Rat   310 HCFCTEKVISNNCTSYGVLDIGKCKEGKPVYISLPHFLHASPDVSEPIEGLNPNEDEHRTYLDVE 374

  Fly   390 PSTGIPLEVAARFQVNMLVEPIQGISLYTGIPRIFF-PLVWFEQKVRITPDMAD--------QLK 445
            |.||..|:.|.|.|||:||:|.:.|.....:.|.:. |::|..:...|..:.|:        ::|
  Rat   375 PITGFTLQFAKRLQVNILVKPARKIEPLKNLKRPYIVPILWLNETGTIGDEKAEMFRNQVTGKIK 439

  Fly   446 VLPIVMLSGHIFAGICLIVGITLLCWTPVQILLASCR 482
            :|.:|.:         :::|:.::.:....|...:||
  Rat   440 LLGLVEM---------VLLGVGVVMFVAFMISYCACR 467

Known Domains:


GeneSequenceDomainRegion External IDIdentity
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 121/469 (26%)
LOC100365047XP_017458226.1 CD36 16..461 CDD:279474 121/471 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.