| Sequence 1: | NP_609121.2 | Gene: | santa-maria / 34024 | FlyBaseID: | FBgn0025697 | Length: | 563 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001107151.1 | Gene: | cd36 / 100135002 | XenbaseID: | XB-GENE-493679 | Length: | 470 | Species: | Xenopus tropicalis |
| Alignment Length: | 499 | Identity: | 146/499 - (29%) |
|---|---|---|---|
| Similarity: | 242/499 - (48%) | Gaps: | 84/499 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 17 LIIG-IFGFCLGLFGILCGMFWVDLFDWIMHKEMA----LAPDTRVYENWKSPPIDLSLDIYLYN 76
Fly 77 W----TNPEDFGNLSTKPILEQVGPY----RFIERPDKVDIHWHPENASVTYRRRSLFYFDAAGS 133
Fly 134 NGSLDDEITTLNAVALSAAATAKYWPPVKRSLVDVGLKMYGAEMSVQKSIDELLFTGYNDAMIDV 198
Fly 199 AMAMPIFGDEVKVPFDKF----GWFYTRNGSADLTGVFNVFTGADQLAKLG---------QMHSW 250
Fly 251 NYQENTGFFDSYCGMTNGSAGEFQPQHLKPGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFSG 315
Fly 316 GPRSVDNGTQYPENLCFC-----GGQCVPSGVMNISSCRFGSPVFMSYPHFFNADPYYPDQVEGL 375
Fly 376 SPNQKDHEFYMVVQPSTGIPLEVAARFQVNMLVEPIQGISLYTGI-PRIFFPLVWFEQKVRITPD 439
Fly 440 MADQLK---VLPIVMLSGHIFAGICLIVGITLLCWTPVQILLAS 480 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| santa-maria | NP_609121.2 | CD36 | 23..474 | CDD:279474 | 140/484 (29%) |
| cd36 | NP_001107151.1 | CD36 | 16..459 | CDD:366481 | 143/492 (29%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1106566at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X155 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.920 | |||||