DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: santa-maria and cd36

Sequence 1:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001107151.1 Gene:cd36 XenbaseID:XB-GENE-493679 Length:470 Species:Xenopus tropicalis

Alignment Length:499 Identity:146/500 (29%)
Similarity:242/500 (48%) Gaps:84/500 (17%)


  Fly    17 LIIG-IFGFCLGLFGILCGMFWVDLFDWIMHKEMA----LAPDTRVYENWKSPPIDLSLDIYLYN 76
            ||:| :.|   ||..||.|:.: .:.|.|::||::    :...|..||||    |:....:|.:.
 Frog     9 LIVGSVIG---GLLAILGGILF-PVGDMIINKEISTEAVIEEGTIAYENW----IEAGSPVYRHF 65

  Fly    77 W----TNPEDFGNLSTKPILEQVGPY----RFIERPDKVDIHWHPENASVTYRRRSLFYFDAAGS 133
            |    |||::..| ..||||:|.|||    |::.:.:...:    ||.:|:|.:.:...|...||
 Frog    66 WIYHVTNPDEIIN-GGKPILQQKGPYTYRVRYLPKENITQL----ENNTVSYWQPNGAIFQREGS 125

  Fly   134 NGSLDDEITTLNAVALSAAATAKYWPPVKRSLVDVGLKMYGAEMSVQKSIDELLFTGYNDAMIDV 198
            .|..:|..|.||...  |||.|.:  |..:.|::..:|...:.:...:|:.|||: ||.|..:: 
 Frog   126 YGPEEDTYTVLNLAV--AAAPAMF--PALQGLLNAIIKSSNSSLFQVRSVKELLW-GYRDPFLE- 184

  Fly   199 AMAMPIFGDEVKVPFDKF----GWFYTRNGSADLTGVFNVFTGADQLAKLG---------QMHSW 250
                       |:|.|..    |.||..||:||  |:::|:.|...::|:.         .:..|
 Frog   185 -----------KIPIDSIDKTTGLFYPNNGTAD--GIYHVYNGKGDISKVAIIDRYKEAKALPYW 236

  Fly   251 NYQENTGFFDSYCGMTNGSAGEFQPQHLKPGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFSG 315
            |        |.:|.|.||:.....|..:|....:..|:.::||:|...:.:...::|::.|:|..
 Frog   237 N--------DDFCDMINGTDAASFPPSVKKDKRLYFFSSEICRSIYGIFEKEYMVKGIKLYRFVV 293

  Fly   316 GPRSVDNGTQYPENLCFC-----GGQCVPSGVMNISSCRFGSPVFMSYPHFFNADPYYPDQVEGL 375
            ...::.:.|:.|:|.|||     ...|..:||:::.||:.|.|:|:|.|||..|..|..|.|.||
 Frog   294 TEDAMASPTKNPDNHCFCKDFQLSRNCTAAGVLDLRSCQGGKPIFLSLPHFLYASDYLLDSVSGL 358

  Fly   376 SPNQKDHEFYMVVQPSTGIPLEVAARFQVNMLVEPIQGISLYTGI-PRIFFPLVWFEQKVRITPD 439
            .||:::||.|:.|:|.||..:..|.|.|||::::|...|.:.:.: ..:.||:.|..:...|..|
 Frog   359 KPNKEEHETYIDVEPITGFTMHFAKRLQVNVMIQPTDKIEVMSKLQSELVFPVAWLNETALIGDD 423

  Fly   440 MADQLK---VLPIVMLSGHIFAGICLIVGITLLCWTPVQILLAS 480
            .|:..|   ..|:.::.         |:.|.|||...|..|..|
 Frog   424 SANMFKSKVTTPMKVVE---------ILRIVLLCVGSVVFLACS 458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 140/485 (29%)
cd36NP_001107151.1 CD36 16..459 CDD:279474 143/493 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.