DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ndae1 and AT5G25430

Sequence 1:NP_723263.2 Gene:Ndae1 FlyBaseID:FBgn0259111 Length:1190 Species:Drosophila melanogaster
Sequence 2:NP_001318647.1 Gene:AT5G25430 AraportID:AT5G25430 Length:671 Species:Arabidopsis thaliana

Alignment Length:689 Identity:155/690 (22%)
Similarity:282/690 (41%) Gaps:178/690 (26%)


  Fly   483 FGGLINDIKRKAPWYISDYKDAL--SMQCVASWIFLYFACLSPIITFGGLLAEATGKHMAAMESL 545
            |.|::.||:.:...|..|:...:  .::.:|...:::||...|::.||..|::.||..::|:|:|
plant    10 FQGILRDIEGRRKCYKQDWIRGIKTGIRILAPTCYIFFASSLPVVAFGEQLSKHTGGALSAVETL 74

  Fly   546 VSGFVCGMGYGFFSGQPLTILGSTGPVLVFESIIYEFCLK---MGWD-YMTFRFWIGMWVAGICI 606
            .|..:||:.:..|.||||.|:|...|.::..:.:|.||:.   :|.: |:.:..|:.:|.:.:.|
plant    75 ASTSICGIIHAIFGGQPLLIVGVAEPTIIMYTYLYSFCISRPDIGRELYLAWVAWVCVWTSVLLI 139

  Fly   607 VLTAIDASALVCYITRFTEENFATLIAFIFIYKAIENVMVIGKNFPVNQGIYDCVCTPPI----- 666
            :|:..:|..::...||...|.|..|||.:|:.:||             :|:......|.|     
plant   140 LLSIFNAGTIITRFTRIAGELFGMLIAVLFLQEAI-------------KGLISEFHAPEIKNQET 191

  Fly   667 GSNASVIDYAKYNWDSCESYNGTLVGGDCGTPPTENVFLMSVVLCAGTFLISTVLKEFKNALFFP 731
            |.:..::.||          ||                |::|:...|..:.:...:..|:..:..
plant   192 GKSHFLLIYA----------NG----------------LLAVIFSLGLLITALKSRRAKSWKYGF 230

  Fly   732 SIVRQYISDFSVLIAIFAMSFFDYSLGVPTQKLEVPNELKPTLSTR-------------GWLIPP 783
            ..:|.:|.|:.|.:.:...:...|:         ||:|:.|::..|             .|.:..
plant   231 GWLRSFIGDYGVPLMVLLWTALSYT---------VPSEVLPSVPRRLFCPLPWEPASLYHWTVVK 286

  Fly   784 FVEKNPWWSAIIAVFPALLGTILIFMDQQITAVIVNRKENKLKKGCGYHLDLFILSILIAICSMM 848
            .:.|.|....:.|..|.::...|.|.|..:.:.:..:||..||....||.|:|:|.|:..||.::
plant   287 DMGKVPIMYILAAFIPGVMIAGLYFFDHSVASQMAQQKEFNLKNPSAYHYDIFLLGIITLICGLL 351

  Fly   849 GLPWFVAATVLSINHVNSLK------------------------------------LESECSAPG 877
            |||........:..|..||.                                    :|.|.|.|.
plant   352 GLPPSNGVLPQAPMHTKSLAVLNRQLIRKKMVKKAKECMKMKASKSEIYGRMQSVFIEMETSPPQ 416

  Fly   878 E-----------------------KPQF-----------LGVREQRVTHILIFLTIGVSVLLTPL 908
            :                       |.:|           :.|.||||:::|..:.:|:::|...:
plant   417 DNSVATDLKELKEVVMRPDEGGDTKGKFDPDVHIEANLPVRVNEQRVSNLLQSVLVGLTLLAVTV 481

  Fly   909 LGNIPMPVLFGVFLYMGVASLKGLQFFDRILIMFMPAKYQPDYM----------FLRQVPIKRVH 963
            :..||..||:|.|.||.:.||.|.||::|:|::|:|    |..:          |:..||.:.:.
plant   482 IKMIPSSVLWGYFAYMAIDSLPGNQFWERLLLLFIP----PSRLFKVLEGVHASFVELVPYRVIV 542

  Fly   964 LFTMIQLACLIILWLIKSFSQTSILFPLMLVVMIGIRK-ALDLVFTRRELKILDDIMPEMTKRAA 1027
            .||:.||...::.:.:.......|.||.:..::|.||: .|..:|..:.|::||           
plant   543 TFTLFQLVYFLLCYGMTWIPMAGIFFPALFFLLISIREHLLPKLFDMQHLQVLD----------- 596

  Fly  1028 ADDLHKLDAEDNHH----------QHPPGSGAGANYNAD 1056
            |.|..::.|....|          .|....|....|:|:
plant   597 ASDYEEIVAAPIQHSSFAYRKLGSSHHLSEGEDEFYDAE 635

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ndae1NP_723263.2 ae 140..1016 CDD:273290 146/638 (23%)
Band_3_cyto 167..435 CDD:284893
HCO3_cotransp 476..968 CDD:279322 134/589 (23%)
AT5G25430NP_001318647.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265068at2759
OrthoInspector 1 1.000 T32251
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.