DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ndae1 and SLC4A5

Sequence 1:NP_723263.2 Gene:Ndae1 FlyBaseID:FBgn0259111 Length:1190 Species:Drosophila melanogaster
Sequence 2:NP_067019.3 Gene:SLC4A5 HGNCID:18168 Length:1137 Species:Homo sapiens

Alignment Length:1191 Identity:491/1192 (41%)
Similarity:691/1192 (58%) Gaps:211/1192 (18%)


  Fly    42 DFEGHRAH--------TVYVGVHVPGGRRHSQRR--RKHHHSG------------PGGGGGGGGG 84
            |...||..        .:::|:.||   .:.||:  :|.|.||            |         
Human    14 DHTNHRRRFPDQKECPPIHIGLPVP---TYPQRKTDQKGHLSGLQKVHWGLRPDQP--------- 66

  Fly    85 GGSIGGSGSVGGGAGKDNVSEKQQEVERPVTPPAQRVQFILGEDVDDGTHVSHPLFSEMGMLVKE 149
                 .....|.|:|..:.......:.|..:|.|:::|.||||: |:..:.:  ||:||..|..:
Human    67 -----QQELTGPGSGASSQDSSMDLISRTRSPAAEQLQDILGEE-DEAPNPT--LFTEMDTLQHD 123

  Fly   150 GDEIEWKETARWIKFEEDVEEGGNRWSKPHVATLSLHSLFELRRLLVNGSVMLDMEAQNLEVMAD 214
            ||::||||:||||||||.|||||.|||||||:|||||||||||..|..|:|:||:::.:|..:.|
Human   124 GDQMEWKESARWIKFEEKVEEGGERWSKPHVSTLSLHSLFELRTCLQTGTVLLDLDSGSLPQIID 188

  Fly   215 LVCDHMVSAGTLPPGVKDKVKDALLRRHRHQHEYAKKTRLPIIRSLADM-RNHSSSKKKKSNSKH 278
            .|.:..:..|.|.|.::::|...||||||||      |:.||.|||||: ::.|::.:..:.|..
Human   189 DVIEKQIEDGLLRPELRERVSYVLLRRHRHQ------TKKPIHRSLADIGKSVSTTNRSPARSPG 247

  Fly   279 SRPAQNLSSITEDM-VKSPSN-----QSMARPGSGTELSEQQHKGNTHFMRKIPPGAEASNILVG 337
            :.|  :|...|||: ::..:|     .:.:|..:...|:....:....||:|||..:||||:|||
Human   248 AGP--SLHHSTEDLRMRQSANYGRLCHAQSRSMNDISLTPNTDQRKNKFMKKIPKDSEASNVLVG 310

  Fly   338 EVDFLERTLSCFIRLSQAVVLGDLTEVPVPTRFVFILLGPPGSQSNFHEIGRAMATLMSDEIFHE 402
            |||||::....|:||.|:.:||.:|||||||||:||||||.|...:::|||||:||||.|::|.:
Human   311 EVDFLDQPFIAFVRLIQSAMLGGVTEVPVPTRFLFILLGPSGRAKSYNEIGRAIATLMVDDLFSD 375

  Fly   403 VAYRARKRDHLLSGVDEFLDAVTVLPPGEWDPTIRIEPPAAIPSQEVRKR--------------- 452
            |||:||.|:.|::|:|||||.|.|||||||||.||||||..:||.:.||.               
Human   376 VAYKARNREDLIAGIDEFLDEVIVLPPGEWDPNIRIEPPKKVPSADKRKSVFSLAELGQMNGSVG 440

  Fly   453 ----------------------------------PPELP-KEEVDEEEEEARLREENGLSRTGRL 482
                                              ..|:| ..|:.||           |..|||.
Human   441 GGGGAPGGGNGGGGGGGSGGGAGSGGAGGTSSGDDGEMPAMHEIGEE-----------LIWTGRF 494

  Fly   483 FGGLINDIKRKAPWYISDYKDALSMQCVASWIFLYFACLSPIITFGGLLAEATGKHMAAMESLVS 547
            ||||..|||||.||:.||:.|...:|.:::.:|:|..|::..|||||||.:||..:...|||.:.
Human   495 FGGLCLDIKRKLPWFPSDFYDGFHIQSISAILFIYLGCITNAITFGGLLGDATDNYQGVMESFLG 559

  Fly   548 GFVCGMGYGFFSGQPLTILGSTGPVLVFESIIYEFCLKMGWDYMTFRFWIGMWVAGICIVLTAID 612
            ..:.|..:..||||||.||.||||:|:||.::::|....|.|||.||.|||:..|..|::|.|.|
Human   560 TAMAGSLFCLFSGQPLIILSSTGPILIFEKLLFDFSKGNGLDYMEFRLWIGLHSAVQCLILVATD 624

  Fly   613 ASALVCYITRFTEENFATLIAFIFIYKAIENVMVIGKNFPVNQGI-------YDCVCTPPIGSNA 670
            ||.::.||||||||.|:|||:|||||.||:.::...|.:|:|...       |.|.|..|...|.
Human   625 ASFIIKYITRFTEEGFSTLISFIFIYDAIKKMIGAFKYYPINMDFKPNFITTYKCECVAPDTVNT 689

  Fly   671 SV-----------------------IDYAKYNWDSCESYNGTLVGGDCGTPPTENVFLMSVVLCA 712
            :|                       :|::..:...|.||.|.|:|..|...|  ::.|||.:|..
Human   690 TVFNASAPLAPDTNASLYNLLNLTALDWSLLSKKECLSYGGRLLGNSCKFIP--DLALMSFILFF 752

  Fly   713 GTFLISTVLKEFKNALFFPSIVRQYISDFSVLIAIFAMSFFDYSLGVPTQKLEVPNELKPTLSTR 777
            ||:.::..||:||.:.:||:.||..::|||::.:|......|...|:.|.||.||:.:|||...|
Human   753 GTYSMTLTLKKFKFSRYFPTKVRALVADFSIVFSILMFCGIDACFGLETPKLHVPSVIKPTRPDR 817

  Fly   778 GWLIPPFVEKNPWWSAIIAVFPALLGTILIFMDQQITAVIVNRKENKLKKGCGYHLDLFILSILI 842
            ||.:.|| .|||||....::.||||.||||||||||||||||||||||||..|||||||.:.||:
Human   818 GWFVAPF-GKNPWWVYPASILPALLVTILIFMDQQITAVIVNRKENKLKKAAGYHLDLFWVGILM 881

  Fly   843 AICSMMGLPWFVAATVLSINHVNSLKLESECSAPGEKPQFLGVREQRVTHILIFLTIGVSVLLTP 907
            |:||.|||||:|||||:||.|::|||:|:|.|||||:||||||||||||.|::|:..|:||.|.|
Human   882 ALCSFMGLPWYVAATVISIAHIDSLKMETETSAPGEQPQFLGVREQRVTGIIVFILTGISVFLAP 946

  Fly   908 LLGNIPMPVLFGVFLYMGVASLKGLQ----------------FFDRILIMFMPAKYQPDYMFLRQ 956
            :|..||:|||:|||||||||||.|:|                |::|..:..||||:|||:.|||.
Human   947 ILKCIPLPVLYGVFLYMGVASLNGIQMGTGGSEFKIQKKLTPFWERCKLFLMPAKHQPDHAFLRH 1011

  Fly   957 VPIKRVHLFTMIQLACLIILWLIKSFSQTSILFPLMLVVMIGIRKALDLVFTRRELKILDDIMPE 1021
            ||::|:||||::|:.||.:||::|| :..:|:||:|::.:|.:|:.||.:|::.:|..:|:|:||
Human  1012 VPLRRIHLFTLVQILCLAVLWILKS-TVAAIIFPVMILGLIIVRRLLDFIFSQHDLAWIDNILPE 1075

  Fly  1022 ----------MTKRAAADDLHKLDAEDNHHQHPPGSGAGANYNADKSGPTTIHIPLSGNKTGTKG 1076
                      ..|:.|.:|.      |...|.||              |:.|.||:...::.   
Human  1076 KEKKETDKKRKRKKGAHEDC------DEEPQFPP--------------PSVIKIPMESVQSD--- 1117

  Fly  1077 PTVNIPQEAVN-----RTAVW 1092
                 ||..::     |::.|
Human  1118 -----PQNGIHCIARKRSSSW 1133

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ndae1NP_723263.2 ae 140..1016 CDD:273290 446/979 (46%)
Band_3_cyto 167..435 CDD:284893 134/275 (49%)
HCO3_cotransp 476..968 CDD:279322 262/538 (49%)
SLC4A5NP_067019.3 ae 114..1070 CDD:273290 446/979 (46%)
Band_3_cyto 141..408 CDD:284893 134/275 (49%)
HCO3_cotransp 488..1023 CDD:279322 262/538 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121600373
eggNOG 1 0.900 E1_KOG1172
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D138594at33208
OrthoFinder 1 1.000 FOG0000084
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126709
Panther 1 1.100 O PTHR11453
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.