DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ndae1 and SPBC543.05c

Sequence 1:NP_723263.2 Gene:Ndae1 FlyBaseID:FBgn0259111 Length:1190 Species:Drosophila melanogaster
Sequence 2:NP_596793.1 Gene:SPBC543.05c PomBaseID:SPBC543.05c Length:517 Species:Schizosaccharomyces pombe

Alignment Length:557 Identity:138/558 (25%)
Similarity:238/558 (43%) Gaps:81/558 (15%)


  Fly   482 LFGG-LINDIKRKAPWYISDYKDALSMQCVASWIFLYFACLSPIITFGGLLAEATGKHMAAMESL 545
            :||. ::||:|::.|:|.||:.||...:.:.:.:.:||:.|.|.:.|...:...|.......|.|
pombe    11 IFGSEIVNDVKKRLPYYKSDWIDACHYRVLPACLNIYFSNLLPELAFALDMFAKTNNSFGVNEVL 75

  Fly   546 VSGFVCGMGYGFFSGQPLTILGSTGPVLVFESIIYEFCLKMGWDYMTFRFWIGMWVAGICIVLTA 610
            ::..:..:.:...|.|||.|:|.|||:.||...:|:.....|..|..|..||.:|......::..
pombe    76 LASVLGSVVFALLSSQPLCIVGVTGPITVFNYTVYDIMHDRGTPYFPFLCWICLWSMIFHFIIAI 140

  Fly   611 IDASALVCYITRFTEENFATLIAFIFIYKAIENVMVIGKNFPVNQGIYDCVCTPPIGSNASVIDY 675
            .:....|.:||:|:.|.|...:|||::.|.::                 .:|           |.
pombe   141 ANGVYFVKHITKFSCEIFGLYVAFIYLEKGVQ-----------------VLC-----------DQ 177

  Fly   676 AKYNWDSCESYNGTLVGGDCGTPPTENVFLMSVVLCAGTFLISTVLKEFKNALFFPSIVRQYISD 740
            .||.                    ..|.|| |:.:.....::..:......:..|...||..:.|
pombe   178 LKYG--------------------LTNTFL-SITIALLFLMVGWLCDTVGKSSLFSYKVRILLLD 221

  Fly   741 FSVLIAIFAMSFFDYSLG----VPTQKLEVPNELKPTLSTRGWLIPPFVEKNPWWSAIIAVFPAL 801
            :.::.:|...|.|.: :|    |...||......:|||| |.|.|..:  |.|.....:|:..::
pombe   222 YGLVASIIFFSGFQH-IGKMREVSLAKLPTTKAFEPTLS-RSWFIKFW--KIPVGDVFLAIPFSI 282

  Fly   802 LGTILIFMDQQITAVIVNRKENKLKKGCGYHLDLFILSILIAICSMMGL----------PWFVAA 856
            :.|||.:.|..:::|:.......|.|..|:|.|.|:|.|...:..::|:          |...||
pombe   283 VLTILFYFDHNVSSVMAQDPSFPLTKPAGFHWDFFLLGITTGVSGILGIPAPNGLIPQAPMHTAA 347

  Fly   857 TVLSINHVNSLKLESECSAPGEKPQFLGVREQRVTHILI-FLTIGVSVLLTPL---LGNIPMPVL 917
              |.:..|:..:.|.|.:   .|.....|.|||.::.:. .:|:|  .:..||   |..||..||
pombe   348 --LCVKRVDYDEDEIEKT---HKEVIDRVVEQRASNFIQGLMTVG--TMTGPLLLVLHQIPQCVL 405

  Fly   918 FGVFLYMGVASLKGLQFFDRILIMFMPAKYQPDYMFLRQVPIKR-VHLFTMIQLACLIILWLIKS 981
            .|:|..||.:::.|......::.|....|.......|.....|| |.|:|::||......:.|..
pombe   406 AGLFWVMGFSAIFGNGITQNVIWMLSDRKVVSKNHTLNHCSSKRVVWLYTILQLIGFGATFAITQ 470

  Fly   982 FSQTSILFPLMLVVMIGIRK-ALDLVFTRRELKILDD 1017
            ..:.||.||::::::|..|. .:...|...:|:|||:
pombe   471 VDKASIGFPIIILLLIPFRTYCMPKWFLEEDLEILDE 507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ndae1NP_723263.2 ae 140..1016 CDD:273290 137/555 (25%)
Band_3_cyto 167..435 CDD:284893
HCO3_cotransp 476..968 CDD:279322 124/506 (25%)
SPBC543.05cNP_596793.1 HCO3_cotransp 12..420 CDD:304903 116/468 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000084
OrthoInspector 1 1.000 T631589
orthoMCL 1 0.900 OOG5_126709
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.817 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1874
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.