DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ndae1 and Slc4a5

Sequence 1:NP_723263.2 Gene:Ndae1 FlyBaseID:FBgn0259111 Length:1190 Species:Drosophila melanogaster
Sequence 2:XP_006506026.1 Gene:Slc4a5 MGIID:2443220 Length:1272 Species:Mus musculus

Alignment Length:1287 Identity:497/1288 (39%)
Similarity:700/1288 (54%) Gaps:282/1288 (22%)


  Fly    20 DDEAPKDPRTGGEDFTQQFTENDFEGHRAHTVYVGVHVPGGRRHSQRR--RKHHHSG-------- 74
            |:|.....:.....:.::..|.||.     ::::|..||.   :|||:  .|.|.||        
Mouse     4 DEEKAGVKKLDPTSYKRRQPEQDFP-----SIHIGFPVPS---YSQRKSDSKGHLSGLQKVQWSL 60

  Fly    75 -PGGG----GGGGGGGGSIGGSGSVGGGAGKDNVSEKQQEVERPVTPPAQRVQFILGEDVDDGTH 134
             ||..    .|.|....|.||:...               .:|..:|.|:::|.||||: |:..:
Mouse    61 KPGKPQQELAGPGIRASSQGGAVDF---------------TKRTRSPAAEQLQDILGEE-DEAPN 109

  Fly   135 VSHPLFSEMGMLVKEGDEIEWKETARWIKFEEDVEEGGNRWSKPHVATLSLHSLFELRRLLVNGS 199
            .:  ||:||..|..:||::||||:||||||||.|||||.|||||||:|||||||||||..|..|:
Mouse   110 PT--LFTEMDTLQHDGDQMEWKESARWIKFEEKVEEGGERWSKPHVSTLSLHSLFELRTCLQTGT 172

  Fly   200 VMLDMEAQNLEVMADLVCDHMVSAGTLPPGVKDKVKDALLRRHRHQHEYAKKTRLPIIRSLADMR 264
            |:||:::.:|..:.|.|.:..:..|.|.|.::::|...|||:||||      |:.||.|||||: 
Mouse   173 VLLDLDSCSLPQIIDDVIEKQIEDGLLRPELRERVSYVLLRKHRHQ------TKKPIHRSLADI- 230

  Fly   265 NHSSSKKKKSNSKHSRPAQNLSSITEDM-VKSPSNQSMARPGSGTELSEQQHKGNT-----HFMR 323
            ..|.|...:|:::.|.....|...|||: ::..::...........:::..|..||     .||:
Mouse   231 GKSVSTTNRSSARSSSAGPTLHRSTEDLRIRQSTSYGHLCHAQSRSMNDISHTPNTDQRKNKFMK 295

  Fly   324 KIPPGAEASNILVGEVDFLERTLSCFIRLSQAVVLGDLTEVPVPTRFVFILLGPPGSQSNFHEIG 388
            |||..:||||:||||||||::....|:||.|:.:||.:|||||||||:||||||.|...:::|||
Mouse   296 KIPKDSEASNVLVGEVDFLDQPFIAFVRLVQSAMLGGVTEVPVPTRFLFILLGPSGRAKSYNEIG 360

  Fly   389 RAMATLMSDEIFHEVAYRARKRDHLLSGVDEFLDAVTVLPPGEWDPTIRIEPPAAIPSQEVRKR- 452
            ||:||||.|::|.:|||:||.|:.|::|:|||||.|.|||||||||.||||||..:||.:.||. 
Mouse   361 RAIATLMVDDLFSDVAYKARNREDLIAGIDEFLDEVIVLPPGEWDPNIRIEPPKKVPSADKRKSV 425

  Fly   453 -----------------------------------------PPELP-KEEVDEE----------- 464
                                                     ..|:| ..|:.||           
Mouse   426 FSLAEPGQMNGSVGGGGASAGGGGSGGGAGGSGAGGVGSGDEAEMPAMHEIGEELIWTGRCPLHT 490

  Fly   465 ----------------------------------------------------EEEARL---REE- 473
                                                                |...|:   |:| 
Mouse   491 WQRACCPEPFLLPVLLAILSLLCAAPLRDGDLTTAVVPHSSESCGSDRIVWGEMNRRIPPVRKEP 555

  Fly   474 ----------------NGLSRTGRLFGGLINDIKRKAPWYISDYKDALSMQCVASWIFLYFACLS 522
                            |.:|: .|.||||..|:|||.||:.||:.|...:|.:::.:|:|..|::
Mouse   556 KHFSRHSLVIVSYSGRNNVSQ-ARFFGGLCLDVKRKLPWFPSDFYDGFHLQSISAVLFIYLGCIT 619

  Fly   523 PIITFGGLLAEATGKHMAAMESLVSGFVCGMGYGFFSGQPLTILGSTGPVLVFESIIYEFCLKMG 587
            ..|||||||.:||..:...|||.:...:.|..:..||||||.||.||||:|:||.::::|....|
Mouse   620 NAITFGGLLGDATDNYQGVMESFLGTAMAGSLFCLFSGQPLIILSSTGPILIFEKLLFDFSKANG 684

  Fly   588 WDYMTFRFWIGMWVAGICIVLTAIDASALVCYITRFTEENFATLIAFIFIYKAIENVMVIGKNFP 652
            .|||.||.|||:..|..|::|.|.|||.::.||||||||.|:|||:|||||.||:.::...|.:|
Mouse   685 LDYMEFRLWIGLHSAIQCLILVATDASFIIKYITRFTEEGFSTLISFIFIYDAIKKMIGAFKYYP 749

  Fly   653 VNQGI-------YDCVC-------------------------------TPPIGS----------- 668
            :|...       |.|.|                               .|.|.|           
Mouse   750 INTDFKPDFITTYKCECVAPDTDGGGRREGFIDENWTSSLSAAWAGIMAPSISSETLVNTTTVNA 814

  Fly   669 ----------------NASVIDYAKYNWDSCESYNGTLVGGDCGTPPTENVFLMSVVLCAGTFLI 717
                            |.:.:|::..:...|.||.|.|:|..|...|  ::.|||.:|..||:.:
Mouse   815 SAPLAPNTNTSLYTPLNLTALDWSLLSKKECLSYGGRLLGSSCQFVP--DLALMSFILFFGTYSM 877

  Fly   718 STVLKEFKNALFFPSIVRQYISDFSVLIAIFAMSFFDYSLGVPTQKLEVPNELKPTLSTRGWLIP 782
            :..||:||.:.:||:.||..::|||::.:|......|...|:.|.||.||:.:|||...|||.:.
Mouse   878 TLTLKKFKFSRYFPTKVRTLVADFSIVFSILLFCGIDACFGLQTPKLHVPSVIKPTRPDRGWFVA 942

  Fly   783 PFVEKNPWWSAIIAVFPALLGTILIFMDQQITAVIVNRKENKLKKGCGYHLDLFILSILIAICSM 847
            || .|||||....::.||||.||||||||||||||||||||||:|..|||||||.:.||:|:||.
Mouse   943 PF-GKNPWWVYPASILPALLVTILIFMDQQITAVIVNRKENKLRKAAGYHLDLFWVGILMALCSF 1006

  Fly   848 MGLPWFVAATVLSINHVNSLKLESECSAPGEKPQFLGVREQRVTHILIFLTIGVSVLLTPLLGNI 912
            .||||:|||||:||.|::|||:|:|.|||||:||||||||||||.:::|:..|:||.|.|:|..|
Mouse  1007 TGLPWYVAATVISIAHIDSLKMETETSAPGEQPQFLGVREQRVTGVMVFILTGISVFLAPILKYI 1071

  Fly   913 PMPVLFGVFLYMGVASLKGLQFFDRILIMFMPAKYQPDYMFLRQVPIKRVHLFTMIQLACLIILW 977
            |||||:|||||||||||.|:||::|..:..||||:|||:.|||.||::|:||||::|:.||.:||
Mouse  1072 PMPVLYGVFLYMGVASLNGIQFWERCKLFLMPAKHQPDHAFLRHVPLRRIHLFTLVQILCLALLW 1136

  Fly   978 LIKSFSQTSILFPLMLVVMIGIRKALDLVFTRRELKILDDIMPEMTKRAAADDLHKLDAEDNHHQ 1042
            ::|| :..:|:||:|::.:|.:|:.|||:|::.:|..:|:|:||..|:..  |..|...::.|. 
Mouse  1137 ILKS-TMAAIIFPVMILGLIIVRRLLDLIFSQHDLAWIDNILPEKDKKET--DKKKKRRKEVHE- 1197

  Fly  1043 HPPGSGAGANYNADKS-------GPTTIHIPLSGNKTGTKGPTVNIPQEAVN 1087
                       .|:|.       .|:.:.||:.|           ||.:..|
Mouse  1198 -----------TAEKEVAMPQFLPPSVVKIPMEG-----------IPSDPQN 1227

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ndae1NP_723263.2 ae 140..1016 CDD:273290 448/1073 (42%)
Band_3_cyto 167..435 CDD:284893 134/274 (49%)
HCO3_cotransp 476..968 CDD:279322 258/557 (46%)
Slc4a5XP_006506026.1 ae 113..1174 CDD:273290 448/1073 (42%)
Band_3_cyto 140..407 CDD:284893 134/274 (49%)
HCO3_cotransp 578..1127 CDD:279322 257/552 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121598126
eggNOG 1 0.900 E1_KOG1172
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D138594at33208
OrthoFinder 1 1.000 FOG0000084
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126709
Panther 1 1.100 O PTHR11453
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.