DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ndae1 and abts-2

Sequence 1:NP_723263.2 Gene:Ndae1 FlyBaseID:FBgn0259111 Length:1190 Species:Drosophila melanogaster
Sequence 2:NP_509936.3 Gene:abts-2 WormBaseID:WBGene00009929 Length:737 Species:Caenorhabditis elegans

Alignment Length:826 Identity:203/827 (25%)
Similarity:354/827 (43%) Gaps:139/827 (17%)


  Fly   236 DALLRRHRHQHEYAKKTRLPIIRSLADMRNHSSSKKKKSNSKHSRPAQNLSSITEDM-------- 292
            :.|.|..|.:|....||.   :|.|.|:.:.........|..||.....|.|:..|:        
 Worm     3 ELLCRTERVEHARNFKTE---VRGLMDVDHLIERACIHRNMNHSHIHTILLSLFSDLSSRFPQEK 64

  Fly   293 ---------VKSPSNQSMARPGSGTELSEQQHKGNTHFMRKIPPGAEASN---ILVGEVDFLERT 345
                     |.|.|::....|....:|  |.:.|...|        :.:.   :...::|.|:::
 Worm    65 FDLALFKNAVFSVSDRDSRAPRLHHKL--QSYSGTDFF--------DVNQTWIVTYAQLDGLKQS 119

  Fly   346 LSCFIRLSQAVVLG-DLTEVPVPTRFVFILLGPPGSQ--SNFHEIGRAMATLMSDEIFHEVAYRA 407
            ......|..|..|| ::.|    .|.|.::|.|...:  .:..||.|..|||:.::...:....|
 Worm   120 HMALATLEDATNLGLEMEE----ARTVVLILSPSYEKHTKSAAEIARTFATLLMNDTLRQSVNDA 180

  Fly   408 RKRDHLLSGVDEFLDAVTVLPPGEWDPTIRIEPPAAIPSQEVRKRPPELPKEEVDEEEEEARLRE 472
            ...|.|...:.|:...:                     ||::..:....|..:.|:|.|     .
 Worm   181 ADDDQLRDLLTEYAKGL---------------------SQQLTIQVNGKPIADDDDEYE-----S 219

  Fly   473 ENGLSRTGRLFGGLINDIKRKAPWYISDYKDALS-----MQCVASWIFLYFACLSPIITFGGLLA 532
            :|........|.||:.|.||:...|.|||.|.:.     .:.:::.:||.|..|...|.:|.|..
 Worm   220 KNSSFCPYYPFRGLVKDFKRRMANYKSDYLDGIKDRRSVSKVISTAVFLIFTILPTSIAYGMLNE 284

  Fly   533 EATGKHMAAMESLVSGFVCGMGYGFFSGQPLTILGSTGPVLVFESIIYEFCLKMGWDYMTFRFWI 597
            ..|...:...:.::..::..:.:|.|.||.|.||.:|.|:.::.::||:......||:......:
 Worm   285 NNTNGAINVQKVVLGQWIGSLLFGIFGGQQLLILSTTAPLSIYIAVIYQVAQTNDWDFFQMYASV 349

  Fly   598 GMWVAGICIVLTAIDASALVCYITRFTEENFATLIAFIFIYKAIENVMVIGKNFPVNQGIYDCVC 662
            |::..|:.|:.:....::|:.:.||.|||.|:..||...|.|||..::.:     ...|...|: 
 Worm   350 GIYAMGLLILASVFQLASLMKFTTRSTEEIFSVFIALALIIKAIMAIVHV-----YTHGYLGCI- 408

  Fly   663 TPPIGSNASVIDYAKYNWDSCESYNGTLVGGDCGTPPTENVFLMSVVLCAGTFLISTVLKEFKNA 727
                 :|                     |.||...|...   |:.:.|..||..:|..:..|:::
 Worm   409 -----NN---------------------VAGDLCDPAEP---LLFIFLLFGTTWLSMTIISFRSS 444

  Fly   728 LFFPSIVRQYISDFSVLIAIFA---MSFFDYSLGVPTQKLEVPNELKPTLSTRGWLIPPFVEKNP 789
            .:.....|..:||:::.||:..   :|||.:| .|..::.::.:.     .|..:.:|.|  ..|
 Worm   445 PYLSRWKRDLVSDYALPIAVLVFSFISFFGFS-DVKKEQFQIFSR-----ETDAFFVPFF--NLP 501

  Fly   790 WWSAIIAVFPALLGTILIFMDQQITAVIVNRKENKLKKGCGYHLDLFILSILIAICSMMGLPWFV 854
            ..:.:.||..|:..:||.||||.:....|:.|:||||||..:|.||.::.:|....|:.||||..
 Worm   502 AEAQLPAVGLAIPLSILFFMDQLLVTNTVDNKDNKLKKGSAHHWDLLVVGVLNIGLSIFGLPWMH 566

  Fly   855 AATVLSINHVNSLK-LESECSAPGEKPQFLGVREQR----VTHILI-----FLTIGVSVLLTPLL 909
            .|...:..|:.:|. :|........:...:.|||.|    :.||::     ||...::|.     
 Worm   567 GALPSAYLHLKALSDVEDRLHNGYIQTVIVHVRETRLATLIAHIIMIPIYFFLVPHITVF----- 626

  Fly   910 GNIPMPVLFGVFLYMGVASLKGLQFFDRILIMFMPAKYQPDYMFLRQVPIKRVHLFTMIQLACLI 974
              ||..:..||||:|..:||.|.:|::|||::|...:..|...::|:||.:.||.||:|:...|:
 Worm   627 --IPTSIFNGVFLFMAFSSLTGNEFWERILLIFTEQRAYPPTHYIRRVPQRVVHQFTIIEFIQLV 689

  Fly   975 ILWLIKSFSQ---TSILFPLMLVVMIGIRKALDLVFTRRE-LKILD 1016
            ||..| .|:|   ..::||:::...|..|.....:|.|:: |:.:|
 Worm   690 ILVAI-GFAQYHYVEMVFPIVIAAFIPFRHFFLPLFIRKQYLEAID 734

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ndae1NP_723263.2 ae 140..1016 CDD:273290 202/825 (24%)
Band_3_cyto 167..435 CDD:284893 44/222 (20%)
HCO3_cotransp 476..968 CDD:279322 137/510 (27%)
abts-2NP_509936.3 PTS_IIA_fru <111..190 CDD:294109 20/83 (24%)
HCO3_cotransp 229..683 CDD:304903 137/504 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1172
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265068at2759
OrthoFinder 1 1.000 FOG0000084
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126709
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1874
TreeFam 1 0.960
65.800

Return to query results.
Submit another query.