DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ndae1 and Slc4a7

Sequence 1:NP_723263.2 Gene:Ndae1 FlyBaseID:FBgn0259111 Length:1190 Species:Drosophila melanogaster
Sequence 2:NP_478118.1 Gene:Slc4a7 RGDID:621208 Length:1254 Species:Rattus norvegicus

Alignment Length:1289 Identity:579/1290 (45%)
Similarity:775/1290 (60%) Gaps:215/1290 (17%)


  Fly    20 DDEAPKDPRTGGEDFTQQFTENDFEGHRAHTVYVGVHVP----GGRRHSQRRRKHHHSGPGGGGG 80
            |:||..|..........:|.:.:.|.|||  ||||||||    ..|||..|..||||.       
  Rat    19 DEEAVVDLGKTSSTVNTKFEKEELESHRA--VYVGVHVPFSKESRRRHRHRGHKHHHR------- 74

  Fly    81 GGGGGGSIGGSGSVGGGAGKDNVSEKQQEVERP-VTPPAQRVQFILGEDVDDGTHVSHPLFSEMG 144
                             ..||..|:|:...|.| ...|:||||||||.:.||..|:.|.||:||.
  Rat    75 -----------------RRKDKDSDKEDGRESPSYDTPSQRVQFILGTEDDDEEHIPHDLFTEMD 122

  Fly   145 ML-VKEGDEIEWKETARWIKFEEDVEEGGNRWSKPHVATLSLHSLFELRRLLVNGSVMLDMEAQN 208
            .| .::|:|.||||||||:|||||||:||:|||||:|||||||||||||..::||:|||||.|..
  Rat   123 ELCYRDGEEYEWKETARWLKFEEDVEDGGDRWSKPYVATLSLHSLFELRSCILNGTVMLDMRAST 187

  Fly   209 LEVMADLVCDHMVSAGTLPPGVKDKVKDALLRRHRHQHEYAKKTRLPIIRSLADM-RNHSSSKKK 272
            |:.:||:|.|:|:::|.|...:::.|::|||:||.||:|....:|:|::||.||: :.||.....
  Rat   188 LDEIADMVLDNMIASGQLDDSIRENVREALLKRHHHQNEKRFTSRIPLVRSFADIGKKHSDPHLL 252

  Fly   273 KSN------SKHS------------RPAQNLSSITEDMVKS----------------------PS 297
            :.|      |:||            |....||.:...::.|                      ||
  Rat   253 ERNGEGLSASRHSLRTGLSASNLSLRGESPLSLLLSHLLPSSRAGTPAGSRCTTPVPTPQNSPPS 317

  Fly   298 NQSMAR----------------------------------------------------------- 303
            :.|::|                                                           
  Rat   318 SPSLSRLTSRSSQQTQPQAPEVLVSPDRDDIPRVVIHPPEEDIEALKGQEQKNEENTDFTPGILA 382

  Fly   304 -----PGSGTELSEQQHKGN-----------------THFMRKIPPGAEASNILVGEVDFLERTL 346
                 ||:.......:.|||                 .:||||||.||||||:||||||||||.:
  Rat   383 SPQSAPGNLDSSKSGEVKGNGSGGSRENSTVDFSKVDMNFMRKIPTGAEASNVLVGEVDFLERPI 447

  Fly   347 SCFIRLSQAVVLGDLTEVPVPTRFVFILLGPPGSQSNFHEIGRAMATLMSDEIFHEVAYRARKRD 411
            ..|:||:.||:|..||||||||||:|:||||.|....:|||||::||||:|||||:|||:|:.|:
  Rat   448 IAFVRLAPAVLLSGLTEVPVPTRFLFLLLGPAGKAPQYHEIGRSIATLMTDEIFHDVAYKAKDRN 512

  Fly   412 HLLSGVDEFLDAVTVLPPGEWDPTIRIEPPAAIPSQEVRKRP----------PELPKEEVDEEEE 466
            .||||:|||||.|||||||||||:||||||.::||||.||.|          .:.|||.......
  Rat   513 DLLSGIDEFLDQVTVLPPGEWDPSIRIEPPKSVPSQEKRKIPAFPNGSAPVSADPPKEADHHAGP 577

  Fly   467 EARLREENGLSRTGRLFGGLINDIKRKAPWYISDYKDALSMQCVASWIFLYFACLSPIITFGGLL 531
            |        |.||||||||||.|||||||:::||:|||||:||:||.:|||.||:||:|||||||
  Rat   578 E--------LQRTGRLFGGLILDIKRKAPFFLSDFKDALSLQCLASILFLYCACMSPVITFGGLL 634

  Fly   532 AEATGKHMAAMESLVSGFVCGMGYGFFSGQPLTILGSTGPVLVFESIIYEFCLKMGWDYMTFRFW 596
            .|||...::|:|||....:.|:.|..|:|||||||||||||||||.|:::||......|::.|..
  Rat   635 GEATEGRISAIESLFGASLTGIAYSLFAGQPLTILGSTGPVLVFEKILFKFCRDYHLSYLSLRTS 699

  Fly   597 IGMWVAGICIVLTAIDASALVCYITRFTEENFATLIAFIFIYKAIENVMVIGKNFPVNQ------ 655
            ||:|.:.:||||.|.|||:|||||||||||.||.||..||||:|:|.:..:|:.:..|.      
  Rat   700 IGLWTSFLCIVLVATDASSLVCYITRFTEEAFAALICIIFIYEALEKLFHLGEIYAFNMHNNLDA 764

  Fly   656 -GIYDCVCTPPIG-SNASV------------IDYAKYNWDSCESYNGTLVGGDCGT--PPTENVF 704
             ..|.|||..|.. ||.:|            |.:|......|::::|..||..||.  |...:|.
  Rat   765 LTSYTCVCAEPSNPSNETVELWERKNVTAASISWANLTVSECKTFHGMFVGSACGPHGPYVPDVL 829

  Fly   705 LMSVVLCAGTFLISTVLKEFKNALFFPSIVRQYISDFSVLIAIFAMSFFDYSLGVPTQKLEVPNE 769
            ...|||...||.:|:.||:||...:||:.||..||||:|.:.|..|...||.:|:|:.||.||.:
  Rat   830 FWCVVLFFTTFFLSSFLKQFKTKRYFPTKVRSTISDFAVFLTIVIMVAIDYLVGIPSPKLHVPEK 894

  Fly   770 LKPTLSTRGWLIPPFVEKNPWWSAIIAVFPALLGTILIFMDQQITAVIVNRKENKLKKGCGYHLD 834
            .:||..:|||:|.|..: ||||:.:||..||||.||||||||||||||:||||:|||||.|||||
  Rat   895 FEPTDPSRGWIISPLGD-NPWWTLLIAAVPALLCTILIFMDQQITAVIINRKEHKLKKGAGYHLD 958

  Fly   835 LFILSILIAICSMMGLPWFVAATVLSINHVNSLKLESECSAPGEKPQFLGVREQRVTHILIFLTI 899
            |.::::::.:||:||||||||||||||:||||||:|||||||||:|:|||:||||||.::||:.:
  Rat   959 LLMVAVMLGVCSIMGLPWFVAATVLSISHVNSLKVESECSAPGEQPKFLGIREQRVTGLMIFILM 1023

  Fly   900 GVSVLLTPLLGNIPMPVLFGVFLYMGVASLKGLQFFDRILIMFMPAKYQPDYMFLRQVPIKRVHL 964
            |:||.:|.:|..||||||:||||||||:||||:||||||.:..||||:|||.::||.||:.:||:
  Rat  1024 GLSVFMTSVLKFIPMPVLYGVFLYMGVSSLKGIQFFDRIKLFGMPAKHQPDLIYLRYVPLWKVHV 1088

  Fly   965 FTMIQLACLIILWLIKSFSQTSILFPLMLVVMIGIRKALDLVFTRRELKILDDIMPEMTKRAAAD 1029
            ||::||.||::||:||: |..:::||:|::.::.:||.:||.||:|||..|||:||| :|:...|
  Rat  1089 FTVVQLTCLVLLWVIKA-SAAAVVFPMMVLALVFVRKLMDLCFTKRELSWLDDLMPE-SKKKKED 1151

  Fly  1030 DLHKLDAEDNHHQHPPGSGAGANYNADKSGPTTIHIPLSGNKTGTKGPTVNIPQEAVNRTAVWQQ 1094
            |..|.:.|:.....   .|.|...:......:.:.||:...|.......|||..| :.:||.|:.
  Rat  1152 DKKKKEKEEAERML---QGDGDTVHLPFERGSLLQIPVKTLKYSIDPSVVNISDE-MAKTAQWKA 1212

  Fly  1095 INKDGNGISEQLIIPVTLKVRQIN-GNHAPSSATLSPRLSPMHEADEYSEAPTN 1147
            ::.:..          ..||.:.| ....|.|.|::....|   :.:|.:|.|:
  Rat  1213 LSMNTE----------NAKVTRPNMSPEKPVSVTINFEDEP---SKKYMDAETS 1253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ndae1NP_723263.2 ae 140..1016 CDD:273290 502/1031 (49%)
Band_3_cyto 167..435 CDD:284893 156/390 (40%)
HCO3_cotransp 476..968 CDD:279322 289/514 (56%)
Slc4a7NP_478118.1 ae 118..1139 CDD:273290 502/1031 (49%)
Band_3_cyto 146..536 CDD:284893 156/390 (40%)
HCO3_cotransp 579..1092 CDD:279322 289/514 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121204136
eggNOG 1 0.900 E1_KOG1172
Hieranoid 1 1.000
Homologene 1 1.000 H2680
Inparanoid 1 1.050 1015 1.000 Inparanoid score I261
OMA 1 1.010
OrthoDB 1 1.010 D138594at33208
OrthoFinder 1 1.000 FOG0000084
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126709
Panther 1 1.100 LDO PTHR11453
Phylome 1 0.910 0.875 Consistency score
TreeFam 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.