DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ndae1 and slc4a3

Sequence 1:NP_723263.2 Gene:Ndae1 FlyBaseID:FBgn0259111 Length:1190 Species:Drosophila melanogaster
Sequence 2:XP_017945570.1 Gene:slc4a3 XenbaseID:XB-GENE-996901 Length:991 Species:Xenopus tropicalis

Alignment Length:1095 Identity:399/1096 (36%)
Similarity:589/1096 (54%) Gaps:162/1096 (15%)


  Fly     3 EKNEYIELPWTMNSSSGDDEAPKDPR--TGGEDFTQQFTENDFEGHRA-HTVYVGVHVPGG---- 60
            |..|| |.....|..|..:.|.::.|  .|.||| ::|. .|||.:.. .::...::.|.|    
 Frog     6 EGEEY-EGKGETNELSRKESASRNMRNSVGHEDF-EEFV-LDFEDYDLWESIKTHLNDPEGTSSC 67

  Fly    61 ---------RRHSQRRRKHHHSGPGGGGGGGGGGGSIGGSGSVGGGAGKDNVSEKQQEVERPVTP 116
                     |||.                                 |.|:.||.|:..:..|:..
 Frog    68 VNLDDQSTLRRHI---------------------------------AAKNRVSRKEPTITAPIWT 99

  Fly   117 PAQRVQFILGEDVDDGTHVSHPLFSEMGMLVKEG-DEIEWKETARWIKFEEDVEEGGNRWSKPHV 180
            .|:|.:       |.|   .|.:|.|:..|:.|| .:::|:||||||||||:||:..:||.||||
 Frog   100 RAKRKR-------DKG---PHEVFVELNELICEGVHKMQWRETARWIKFEENVEQETSRWGKPHV 154

  Fly   181 ATLSLHSLFELRRLLVNGSVMLDMEAQNLEVMADLVCDHMVSAGTLPPGVKDKVKDALLRRHRHQ 245
            |:||..||.|||:.:.||::.||:|...:..:...:.|.||.:..:....:..|:.|||.:|.|.
 Frog   155 ASLSFRSLLELRKTITNGTLFLDLEQTTMPRIVQTIVDTMVVSEQIGACDRASVQRALLLKHSHP 219

  Fly   246 HEYAKKTRLPIIRSLADMRNHSSSKKKKSNSKH----SRPAQNLSSITEDMVKSPSNQSMARPGS 306
            ::..:             .:|..|....|...|    |.|.:|..|      ||....|..:..:
 Frog   220 NDGRE-------------AHHPRSSTGSSTGNHLENNSPPIENSFS------KSHDADSKQKTLN 265

  Fly   307 GTELSEQQHKGNTHFMRKIPPGAEASNILVGEVDFLERTLSCFIRLSQAVVLGDLTEVPVPTRFV 371
            |.|....:|   ...|.|||..|||:.:|||.|||||:..:.|:||.:||:|..:.|||:|.||:
 Frog   266 GPEGHRMKH---WKLMEKIPENAEATVVLVGCVDFLEQAATAFVRLDEAVLLESVLEVPIPVRFL 327

  Fly   372 FILLGPPGSQSNFHEIGRAMATLMSDEIFHEVAYRARKRDHLLSGVDEFLDAVTVLPPGEWDPTI 436
            ::||||..:..::|||||:::|||||::|||.||.|..|..||:.::||||...||||.|.....
 Frog   328 YVLLGPTQANMDYHEIGRSISTLMSDKVFHEAAYTAAGRQDLLNAINEFLDCSMVLPPCEMQSKD 392

  Fly   437 RIEPPAAIPSQEVRKR-------------PPELPKEEV--------DEEEEEARLREENGLSRTG 480
            .:...||.....:|||             ||.:..:.|        |||::|:   :.:.|.|:|
 Frog   393 LLRSIAAFQKDLLRKRREREQRRSARENVPPTVQGQSVEARQLKPDDEEDDES---QSDPLERSG 454

  Fly   481 RLFGGLINDIKRKAPWYISDYKDALSMQCVASWIFLYFACLSPIITFGGLLAEATGKHMAAMESL 545
            .|||||:.||:|:...|.||.||.|:.||:|:.:|:|||.|||.|||||||.|.|...|...|.:
 Frog   455 YLFGGLVRDIRRRYVKYWSDIKDGLNSQCLAAALFIYFAALSPAITFGGLLGEKTQGLMGVSELI 519

  Fly   546 VSGFVCGMGYGFFSGQPLTILGSTGPVLVFESIIYEFCLKMGWDYMTFRFWIGMWVAGICIVLTA 610
            ||..|.|:.:...:.|||.|:|.:||:||||...::||.....:|:|.|.|||.|:....:|:.|
 Frog   520 VSTSVLGVIFALLAAQPLLIVGFSGPLLVFEEAFFKFCQVQEIEYLTGRVWIGFWLIFFILVMVA 584

  Fly   611 IDASALVCYITRFTEENFATLIAFIFIYKAIENVMVIGKNFPVNQGIYDCVCTPPIGSNASVIDY 675
            .:.|.||.||:.||:|.||.||:.|||::....:..:....|:.:      ..||:|:       
 Frog   585 AEGSFLVRYISPFTQEIFAFLISLIFIHETFYKLYKVFAEHPLLR------TYPPVGA------- 636

  Fly   676 AKYNWDSCESYNGTLVGGDCGTPP--TENVFLMSVVLCAGTFLISTVLKEFKNALFFPSIVRQYI 738
                          :||......|  ..|..|:|::|..|||||:..|::|||:.|.....|:.|
 Frog   637 --------------VVGRTAALGPRMQPNTALLSLILMVGTFLIAFFLRKFKNSRFLGGQARRVI 687

  Fly   739 SDFSVLIAIFAMSFFDYSL-GVPTQKLEVPNELKPTL-STRGWLIPPFVEKNPW--WSAIIAVFP 799
            .||.:.|:|..|.|.||:: ...||||.||:.|..|. ..|||.|.|.....|:  |....:..|
 Frog   688 GDFGIPISILVMVFIDYAITDTYTQKLNVPSGLSVTSPGKRGWFIDPMGTSKPFPLWMMFASAIP 752

  Fly   800 ALLGTILIFMDQQITAVIVNRKENKLKKGCGYHLDLFILSILIAICSMMGLPWFVAATVLSINHV 864
            |||..||:||:.|||.:||:|||.:|:||.|:||||.::..|..:|::.||||..|.||.|:.|:
 Frog   753 ALLVFILMFMETQITTLIVSRKERRLQKGSGFHLDLLLIGSLGGVCALFGLPWLTATTVRSVTHI 817

  Fly   865 NSLKLESECSAPGEKPQFLGVREQRVTHILIFLTIGVSVLLTPLLGNIPMPVLFGVFLYMGVASL 929
            |:|.:.|: :||||||:...|:|||||.:||...:|:|:::..:|..||:.||||:||||||.||
 Frog   818 NALTVMSK-TAPGEKPRIAEVKEQRVTAVLISALVGLSIVMGEMLRQIPLAVLFGIFLYMGVTSL 881

  Fly   930 KGLQFFDRILIMFMPAKYQPDYMFLRQVPIKRVHLFTMIQLACLIILWLIKSFSQTSILFPLMLV 994
            .|:|.|:|:|::.|..|:.|::.::.:|...|:||||.:||:|::|||::|| |..|:.||.:|:
 Frog   882 TGIQLFERLLLILMHPKHHPEHPYVVKVCTWRMHLFTCVQLSCIVILWVVKS-SPASLAFPFLLI 945

  Fly   995 VMIGIRK-ALDLVFTRRELKILD--DIMPEMTKRAAADDLHKLDAEDNHHQ-HPP 1045
            :.:.:|: .|...|..||||.||  |:.|...:          |..|.::: |.|
 Frog   946 LTVPLRRFVLPRFFQERELKALDSEDVEPNFDE----------DGRDEYNELHMP 990

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ndae1NP_723263.2 ae 140..1016 CDD:273290 360/909 (40%)
Band_3_cyto 167..435 CDD:284893 103/272 (38%)
HCO3_cotransp 476..968 CDD:279322 208/498 (42%)
slc4a3XP_017945570.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121847824
eggNOG 1 0.900 E1_KOG1172
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265068at2759
OrthoFinder 1 1.000 FOG0000084
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.