DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ndae1 and slc4a11

Sequence 1:NP_723263.2 Gene:Ndae1 FlyBaseID:FBgn0259111 Length:1190 Species:Drosophila melanogaster
Sequence 2:XP_002936409.2 Gene:slc4a11 XenbaseID:XB-GENE-482085 Length:867 Species:Xenopus tropicalis

Alignment Length:988 Identity:242/989 (24%)
Similarity:411/989 (42%) Gaps:232/989 (23%)


  Fly   140 FSEMGMLVKEGDE-IEWKETARWIKFEEDVEEGG---NRWSKPHVATLSLHSLFELRRLLVNGSV 200
            |.|.|.|..:.|: .:.||           ||||   ..:...|.:.:|..|:    |..||   
 Frog    26 FEETGYLKCDTDDGCDPKE-----------EEGGGGEELFDTVHSSIVSGESI----RFFVN--- 72

  Fly   201 MLDMEAQNLEVMADLVCDHMVSAGTLPPGVKDKVK----DALLRRHRHQHEYAKKTRLPIIRSLA 261
                  .||||......::..|...|....:..:|    :..:|.||....:..|..:.:     
 Frog    73 ------VNLEVPQSTTAENESSGCVLLHTSRKYLKLKNFEEEVRAHRDLDGFLAKASIIL----- 126

  Fly   262 DMRNHSSSKKKKSNSKHSRPAQNLSSITEDMVK----SPSNQSMARPGSG---------TELSEQ 313
                             ...|.:|..:..:|:|    .|.|   |.|...         |: |..
 Frog   127 -----------------DETATSLDDVLREMLKHFVEDPEN---AEPSCNFNKIMSTLFTD-SGA 170

  Fly   314 QHKGNTHFMRKIPPG--AEASNI--------LVGEVDFLERTLSCFIRLSQAVVLGDLTEVPVPT 368
            ..:||.|.:.....|  |.|:.:        ::..:..|::...|..||.:....|   |.....
 Frog   171 PREGNVHLLSDTIQGVTATATGVQYQQSWLCIICTIKSLQKRHVCISRLERPQNWG---ENSCEV 232

  Fly   369 RFVFILLGPPGSQS--NFHEIGRAMATLMSD-------------EIFHEVAYRARKRDHLLSGVD 418
            |||.::|.||..:|  ...|:||..:|:.||             |.|.|.....|   |||:.|:
 Frog   233 RFVILVLAPPKMKSTKTATEVGRTFSTMFSDINFRQKLLETKTEEEFKEALVHQR---HLLTLVN 294

  Fly   419 EFLDAVTVLPPGEWDPTIRIEPPAAIPSQEVRKRPPELPKEEVDEEEEEARLREENGLSRTGRLF 483
            :.    :.|..|                .:|:...|             .:|.|...:.:     
 Frog   295 KH----SSLNDG----------------HKVQSHKP-------------LKLNEFFNVGK----- 321

  Fly   484 GGLINDIKRKAPWYISDYKDAL------SMQCVASWIFLYFACLSPIITFGGLLAEATGKHMAAM 542
             |:.:||.|:.|.|..|:.|.:      ..:.:.:.||||||||.|.|.||.|..|:|...:...
 Frog   322 -GIFDDIARRLPVYPLDFTDGIIGNNKAIGKYITTMIFLYFACLLPSIAFGSLNDESTAGVIDVQ 385

  Fly   543 ESLVSGFVCGMGYGFFSGQPLTILGSTGPVLVFESIIYEFCLKMGWDYMTFRFWIGMWVAGICIV 607
            :::|...:.|:.|..||||||.:|.:|.|:.::.::|...|.....|:..|..|.|:|.:...|:
 Frog   386 KTIVGQCIGGVIYSLFSGQPLVVLLTTAPLALYINVIRGICDDYNLDFKAFYAWTGLWNSCFLIL 450

  Fly   608 LTAIDASALVCYITRFTEENFATLIAFIFIYKAIENVMVIGKNFPVNQGIYDCVCTPPIGSNASV 672
            .:..:.|.|:....|.|||..|..|:..|:..|::.::.|.|.:.:.           |.|:.:.
 Frog   451 YSLFNCSLLMKLFKRSTEEIIALFISITFVLDALKGIIKIFKKYYLE-----------IPSSHTY 504

  Fly   673 ID--YAKY----NWDS----CESYNGTLVGGDCGTPPTENVF------LMSVVLCAGTFLISTVL 721
            .|  |.|:    |:.|    ..::||::...: |:...|.:.      ::|::|..||..:...|
 Frog   505 PDQEYNKHLPNLNFTSDVLLNSTFNGSVFAPN-GSSDHEEIHYGRESAVLSLMLMFGTLWLGHTL 568

  Fly   722 KEFKNALFFPSIVRQYISDFSVLIAIFAMSF-------------FDYSLGVPTQKLEVPNELKPT 773
            .:||.:.:..|.||:.:||.::.|::...|.             |:|   :.|:.:.|   |.|.
 Frog   569 YQFKKSPYLHSRVREMLSDCALPISVLTFSVVGSYFFKEIHIAKFNY---IKTESMFV---LAPI 627

  Fly   774 LSTRGWLIPPFVEKNPWWSAIIAVFPALLGTILIFMDQQITAVIVNRKENKLKKGCGYHLDLFIL 838
            .|         :...|..||:...|   |.::|.|::|.|.|.:.|..||:|.||..||.||.::
 Frog   628 GS---------LPMGPITSAMGLGF---LLSMLFFIEQNIVASLTNAPENRLVKGTAYHWDLLLV 680

  Fly   839 SILIAICSMMGLPWFVAATVLSINHVNSLK--LESECSAPGEKPQFLGVREQRVTHILIFLTIGV 901
            :::....|:.|:||..||.:.|.|.....:  .:.|.|........:.|||.|:|.::..:.:|:
 Frog   681 ALINTGLSVFGMPWIHAAFLHSHNARAGARQSWKREWSTGHIYETIVSVRETRLTSLVANVLVGL 745

  Fly   902 SVLLTPL-LGNIPMPVLFGVFLYMGVASLKGLQFFDRILIMFMPAKYQPDYMFLRQVPIKRVHLF 965
            |:.|.|. |..||.|||:|:|||:.:.|:.|.|.|:|:.::.......|...::|:||.:::|.|
 Frog   746 SLFLLPYPLQWIPKPVLYGLFLYIALTSIDGSQLFERVALLLKEQTAYPPTHYIRRVPQRKIHYF 810

  Fly   966 TMIQLACLIIL--WLIKSFSQTSILFPLMLVVMIGIRKALDLVFTRRELKILDDIMPEMTKRAAA 1028
            |.:|:..|:||  :.:.......::|||:::.||.||.               :::|::.     
 Frog   811 TGLQVLQLVILCGFGMSPLPYMKMIFPLIMIGMIPIRY---------------NLLPKII----- 855

  Fly  1029 DDLHKLDAEDNHH 1041
             :...|||.|..|
 Frog   856 -ESKYLDAMDAEH 867

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ndae1NP_723263.2 ae 140..1016 CDD:273290 236/962 (25%)
Band_3_cyto 167..435 CDD:284893 66/313 (21%)
HCO3_cotransp 476..968 CDD:279322 148/530 (28%)
slc4a11XP_002936409.2 HCO3_cotransp 320..811 CDD:279322 147/527 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1172
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265068at2759
OrthoFinder 1 1.000 FOG0000084
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.870

Return to query results.
Submit another query.