DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nuf2 and CCDC39

Sequence 1:NP_609096.2 Gene:Nuf2 FlyBaseID:FBgn0031886 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_852091.1 Gene:CCDC39 HGNCID:25244 Length:941 Species:Homo sapiens

Alignment Length:578 Identity:101/579 (17%)
Similarity:187/579 (32%) Gaps:228/579 (39%)


  Fly     4 SVEIERV----MDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFRLEPPYKIGTELGHS 64
            ::|:.|:    .::.|.:...|...:|::.|.||             |..|:            |
Human   245 ALELARIKQETREKENLVKEKIKFLESEIGNNTE-------------FEKRI------------S 284

  Fly    65 SREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKPAVKKTLATLSYLFNHLA------------ 117
            ..:.::...|...|.....:|....:    :|.:|..|.:|.:.|..|..:::            
Human   285 VADRKLLKCRTAYQDHETSRIQLKGE----LDSLKATVNRTSSDLEALRKNISKIKKDIHEETAR 345

  Fly   118 -------------YYKVFKKKVLGPVEEAIKLKDSLTAEVK-----------------AKSQQLE 152
                         ..|...:|.:...|:|..|:|.|..|.|                 .|:|:|:
Human   346 LQKTKNHNEIIQTKLKEITEKTMSVEEKATNLEDMLKEEEKDVKEVDVQLNLIKGVLFKKAQELQ 410

  Fly   153 QCSQKTK------------------------------------------DCEVAINKLKKDL--- 172
            ..:.|.|                                          ..|..:::||.::   
Human   411 TETMKEKAVLSEIEGTRSSLKHLNHQLQKLDFETLKQQEIMYSQDFHIQQVERRMSRLKGEINSE 475

  Fly   173 --QDTQAKLLPLKKSCSEHENTLELIEQQ------------------------------------ 199
              |..:||::.|:||..|.::|..|:|.|                                    
Human   476 EKQALEAKIVELRKSLEEKKSTCGLLETQIKKLHNDLYFIKKAHSKNSDEKQSLMTKINELNLFI 540

  Fly   200 ---QGELDKRIGHWEQLVVEDS----QVTELREKIKSASSHVESC-------------------- 237
               :.||||..|..:.|::||:    :|...||.:.|.:..|.|.                    
Human   541 DRSEKELDKAKGFKQDLMIEDNLLKLEVKRTREMLHSKAEEVLSLEKRKQQLYTAMEERTEEIKV 605

  Fly   238 -KTELASKKQVTNEHRRMI--------------ENSQHIATAL-------EKATAVLSLCKVDDY 280
             ||.|||:.:..::.|..|              :|...|.|.:       |:.|....:.|....
Human   606 HKTMLASQIRYVDQERENISTEFRERLSKIEKLKNRYEILTVVMLPPEGEEEKTQAYYVIKAAQE 670

  Fly   281 KESF---------------KQLEAVEKQLP---TCKVNYQKLLQDAEAKKQELALCAHRYEERNQ 327
            ||..               |::.|:|..|.   :|..||::..:.......|..|.....|::..
Human   671 KEELQREGDCLDAKINKAEKEIYALENTLQVLNSCNNNYKQSFKKVTPSSDEYELKIQLEEQKRA 735

  Fly   328 ENDAENHKVQNELKKLQVDVEDRKKRLEDLNNHLIELDQQNLEQDQLYAI-LNEQIHE 384
            .::...:| |.::::||.|::..:..| |:..||....::.|.:.|.|:. |:::..|
Human   736 VDEKYRYK-QRQIRELQEDIQSMENTL-DVIEHLANNVKEKLSEKQAYSFQLSKETEE 791

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nuf2NP_609096.2 Nuf2 20..114 CDD:281753 17/94 (18%)
CCDC39NP_852091.1 Smc 22..848 CDD:224117 101/579 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.