DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nuf2 and ccdc39

Sequence 1:NP_609096.2 Gene:Nuf2 FlyBaseID:FBgn0031886 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_001344625.2 Gene:ccdc39 ZFINID:ZDB-GENE-110603-1 Length:191 Species:Danio rerio

Alignment Length:108 Identity:27/109 (25%)
Similarity:44/109 (40%) Gaps:15/109 (14%)


  Fly   148 SQQLEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQGELDKRIGHWEQ 212
            |..||...|:.|       .|.:.::.|||.:|.|.|.....|..:....:|..:..|.|...:|
Zfish     2 SNTLEGLLQEEK-------VLNEGIERTQAHVLSLNKDILSQEEKINRAVKQCAKYTKEIRSGKQ 59

  Fly   213 LVVE-----DSQVTELREKIKSASSHVESC---KTELASKKQV 247
            ...:     |.::.|||:..||.:..:...   ..||:|..|:
Zfish    60 STEKTFEERDIELRELRDFNKSINKMLLDAMEGNPELSSILQI 102

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nuf2NP_609096.2 Nuf2 20..114 CDD:281753
ccdc39XP_001344625.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.