DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab30 and RAB37

DIOPT Version :10

Sequence 1:NP_609094.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001006639.1 Gene:RAB37 / 326624 HGNCID:30268 Length:223 Species:Homo sapiens


Alignment Length:209 Identity:90/209 - (43%)
Similarity:127/209 - (60%) Gaps:17/209 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQG-ATIGVDFMIKTVEVEGEKIKLQIWDTAGQE 67
            |....|::|:|:.||||||.:.:|..|.|..|.. ||:|:||..|.|.|:|.::|||||||||||
Human    26 YDLTGKVMLLGDTGVGKTCFLIQFKDGAFLSGTFIATVGIDFRNKVVTVDGVRVKLQIWDTAGQE 90

  Fly    68 RFRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGNKTD-RDDREIPT 131
            ||||:|.:|||.|.||:|:|||:.:.:||.:..||.||.|||...|:.:|:|||.| ..:|.|.:
Human    91 RFRSVTHAYYRDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDVVIMLLGNKADMSSERVIRS 155

  Fly   132 QIGEEFAKQHDMYFLETSAKEAENVERLFYEIAAELIGQARSKDGSSSAAAAAAQRQSEGSSIGL 196
            :.||..|:::.:.|||||||...|||..|..||.||              ...|..|::..|..:
Human   156 EDGETLAREYGVPFLETSAKTGMNVELAFLAIAKEL--------------KYRAGHQADEPSFQI 206

  Fly   197 GSF-SAKAAQSNCC 209
            ..: .::..:|:||
Human   207 RDYVESQKKRSSCC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab30NP_609094.1 Rab30 1..168 CDD:133314 83/165 (50%)
RAB37NP_001006639.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Rab26 31..220 CDD:206695 87/202 (43%)
Switch 1. /evidence=ECO:0000250|UniProtKB:P62820 52..67 6/14 (43%)
Switch 2. /evidence=ECO:0000250|UniProtKB:P62820 85..102 13/16 (81%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.