DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43322 and COG4

Sequence 1:NP_609092.1 Gene:CG43322 FlyBaseID:FBgn0263027 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_015430.1 Gene:COG4 SGDID:S000006309 Length:861 Species:Saccharomyces cerevisiae

Alignment Length:476 Identity:82/477 (17%)
Similarity:152/477 (32%) Gaps:165/477 (35%)


  Fly    19 LLH--LKRKEVYMECFRILGVHESADQNTVRHAYLDLVKRVHPDSGTEEASAERFQQ-VDEAFRV 80
            |.|  |:.|:..:....|..:....|:..:   ..:..|:|.|.|...|..|...:. ..|...:
Yeast   139 LAHSALETKDYLVAATAINEIRSLPDKKLI---VSEFAKKVVPSSEIPEEPAILIKNWCKELTSL 200

  Fly    81 LQEKFAKGRRNIQEDEEGAMEF---------------------DIKHTAPQHRQYLSNEGIGVGT 124
            .||:|.:..|. |:.:|..:.|                     ||  .|.:.|:.:|| .:...|
Yeast   201 FQEQFMEATRT-QDIKELTLMFKMFPMIGQDVLGLDLYSKYVCDI--IADESRKIMSN-SMENST 261

  Fly   125 PFQ--------------------RQKQYQQVRAMKAQERVLEHRIDKAAAGEKTLMSKGGSHFRK 169
            .||                    ..|........|....|:| :::|.|..:.:|:.......||
Yeast   262 KFQGFFSQVLLHLFKIVSTIINDHSKVIATCYGKKHMVHVME-KVEKEADLQASLILDIFMETRK 325

  Fly   170 HAIKTKYGIDRVVEDLIQ-EAMSKGDFNNLNGSGKPLSSAQSQNPYLDFTTHKL----------- 222
                    |:|.:.|:.: |...|.:..|::.:...:.:..........:.|.|           
Yeast   326 --------IERTIHDINEWEHSQKNEDVNIDSNQSDIETDGETEKSSIISIHDLALLIMEFSQIL 382

  Fly   223 -NKIMLDNGFTPEWISLGKDIRDAIAQ---------LKTKLRQERKYYGEWPLQRPDDLAAWKIF 277
             |..|....::.:|... .|:...:.|         ...||:|::.:         |:   :::|
Yeast   383 QNWSMYSRFYSVKWNEF-SDLHPHVLQPPPPIADGKFALKLKQDKVF---------DE---FQVF 434

  Fly   278 TLNH----------QDDVKQLNKLI------DKYNLIVPI------------------------- 301
            .|||          .:::..||.||      |..|:..|:                         
Yeast   435 VLNHLQRSFRNSISLEELPSLNDLITAVPLNDHDNISYPVTSVLDDLILLVRKNLISVVNTGQFK 499

  Fly   302 ------------LENQF--------FRLHLDRMAEPIF---------KDPELQRNVIRPEMKSKP 337
                        .:|:|        |:|...::|..:.         :.....|:|..|..|..|
Yeast   500 LLASFLNELVKFFQNRFLVKFMQNKFKLLQSKLASNVSLKRYIPKGEEQSATSRSVSPPANKFSP 564

  Fly   338 SSNLENQGSASTSLFSLISKL 358
            .|....:|:|:::|.::.|.|
Yeast   565 LSRFTFRGAAASALTNIQSNL 585

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43322NP_609092.1 DnaJ 29..84 CDD:197617 11/56 (20%)
PLN03085 <168..313 CDD:215566 34/228 (15%)
DUF1992 181..250 CDD:286440 11/91 (12%)
COG4NP_015430.1 Cog4 190..526 CDD:214809 57/362 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280567372
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24016
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.