DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43322 and ATJ1

Sequence 1:NP_609092.1 Gene:CG43322 FlyBaseID:FBgn0263027 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_174142.1 Gene:ATJ1 AraportID:AT1G28210 Length:427 Species:Arabidopsis thaliana

Alignment Length:130 Identity:35/131 (27%)
Similarity:58/131 (44%) Gaps:22/131 (17%)


  Fly     7 LFKGSVAIRFGRLLHLK--RKEVYMECFRILGVHESADQNTVRHAYLDLVKRVHPDSGTEEASAE 69
            |.:||....|.|.:|..  ........:.:|||...|.:..::.::.:|.|:.|||:.....||:
plant    23 LRQGSQKPLFERYIHATGINNSSARNYYDVLGVSPKATREEIKKSFHELAKKFHPDTNRNNPSAK 87

  Fly    70 R-FQQVDEAFRVLQEKFAKGRRNIQEDEEGAMEFDIKHTAPQHR--QYLSNEGIGVGTPFQRQKQ 131
            | ||::.||:..|        .|.:..||        :...|:|  .|::|:| |....|:|..|
plant    88 RKFQEIREAYETL--------GNSERREE--------YDKLQYRNSDYVNNDG-GDSERFRRAYQ 135

  Fly   132  131
            plant   136  135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43322NP_609092.1 DnaJ 29..84 CDD:197617 17/56 (30%)
PLN03085 <168..313 CDD:215566
DUF1992 181..250 CDD:286440
ATJ1NP_174142.1 DnaJ 45..391 CDD:223560 29/109 (27%)
DnaJ 48..110 CDD:278647 20/78 (26%)
DnaJ_C 157..371 CDD:199909
DnaJ_zf 186..242 CDD:199908
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.