DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43322 and AT5G03560

Sequence 1:NP_609092.1 Gene:CG43322 FlyBaseID:FBgn0263027 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001154694.1 Gene:AT5G03560 AraportID:AT5G03560 Length:363 Species:Arabidopsis thaliana

Alignment Length:290 Identity:59/291 (20%)
Similarity:86/291 (30%) Gaps:114/291 (39%)


  Fly    59 PDSGT------EEASAERFQQVDEAF--RVL------QEKFAKGRRN------------------ 91
            ||..|      |:.:.|||..|.:|.  |.|      :..|.:.:||                  
plant    61 PDDLTASSKRKEKKTTERFSAVIDAVHDRKLPPELRGRRDFVRSKRNSNSLFPWFCGGVFARQFS 125

  Fly    92 ------------------IQEDEEGAMEFDIKHTAPQHRQYLSNEGIGVGTPFQRQKQYQQVRAM 138
                              ..|:.|..:..|.|...|....|         .||.::...::....
plant   126 SETKRVNTKVNFSLSDDDSDEETETQVTEDSKKQEPPPPPY---------DPFSKKPAIEEPEDP 181

  Fly   139 KAQERVLEHRIDKAAAGEKTLM----SKGGSHFRKH-------AIKTKYGI-DRVVEDLIQEAMS 191
            |..:.:......:....|...|    ||.|   |.|       .||.|..: |.|....|.||.:
plant   182 KNLQEIFHKMRTEGFTNEAVKMFDALSKDG---RTHEALELFSQIKDKNRMPDVVAHTAIVEAYA 243

  Fly   192 KGDFNNLNGSGKP--------LSSAQSQNPY----------LDFTTHKLNK----IMLDNGFTPE 234
            ..      |..|.        |:|..|.|.|          .|..|||..|    .|:.||.:|.
plant   244 NA------GQAKETLKVFMRMLASGVSPNAYTYSVLIKGLAADGKTHKDAKKYLLEMMGNGMSPN 302

  Fly   235 ----------WISLGKD--IRDAIAQLKTK 252
                      ::..||:  .|:.:.::|.|
plant   303 AATYTAVFEAFVREGKEESARELLQEMKGK 332

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43322NP_609092.1 DnaJ 29..84 CDD:197617 11/39 (28%)
PLN03085 <168..313 CDD:215566 31/128 (24%)
DUF1992 181..250 CDD:286440 23/103 (22%)
AT5G03560NP_001154694.1 PPR repeat 203..226 CDD:276811 8/26 (31%)
PPR_2 230..278 CDD:289786 12/54 (22%)
PPR 233..267 CDD:273253 10/40 (25%)
PPR repeat 234..261 CDD:276811 6/33 (18%)
PPR_2 265..315 CDD:289786 11/50 (22%)
PPR repeat 267..297 CDD:276811 7/30 (23%)
PPR 268..303 CDD:273253 10/35 (29%)
PPR_2 301..>338 CDD:289786 6/33 (18%)
PPR repeat 303..332 CDD:276811 4/29 (14%)
PPR 305..338 CDD:273253 5/29 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133310
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
21.810

Return to query results.
Submit another query.