DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43322 and dnajc28

Sequence 1:NP_609092.1 Gene:CG43322 FlyBaseID:FBgn0263027 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001017648.1 Gene:dnajc28 ZFINID:ZDB-GENE-050417-130 Length:376 Species:Danio rerio

Alignment Length:336 Identity:128/337 (38%)
Similarity:205/337 (61%) Gaps:29/337 (9%)


  Fly    30 ECFRILGVHE--SADQNTVRHAYLDLVKRVHPDSGTEEASAERFQQVDEAFRVL------QEKFA 86
            |.:|:|.:.:  ::....|:.|||.:.|..|||||...|.|:.|.|::||:|.:      |:..:
Zfish    40 ESYRLLQLPDDGASGPAEVKEAYLRMAKLYHPDSGAPTADADLFSQIEEAYRAVLAHLARQKSAS 104

  Fly    87 KGRRNIQEDEEGAMEFDIKHTAPQHRQYLSNEGIGVGTPFQRQKQYQQVRAMKAQERVLEHR--- 148
            :..::::|||:.    .:|..|||||||||.||:|.|||.||::||:|.|..:|.::|||:|   
Zfish   105 QYTQSMEEDEDE----KVKGNAPQHRQYLSFEGVGSGTPSQRERQYRQFRVDRATDQVLEYRRKE 165

  Fly   149 IDKAAAGEKTLMSKGGSHFRKHAIKTKYGIDRVVEDLIQEAMSKGDFNNLNGSGKPLSSAQSQNP 213
            ::||||.|..:::: .:..|...||....::|:|||||||:|::|||.||:|:||||:.. ..||
Zfish   166 MEKAAAEEGAMVAR-DARLRSKKIKITQAVERLVEDLIQESMARGDFQNLSGTGKPLNKF-DYNP 228

  Fly   214 YLDFTTHKLNKIMLDNGFTPEWISLGKDIRDAIAQLKTKLRQERKYYGEWPLQRPDDLAAWKIFT 278
            |:|..||.||:|::|||:.||||...|:||::|.:::.:|::.|...|| |::..:.| .||...
Zfish   229 YMDPMTHNLNRILIDNGYQPEWIVAQKEIRESICKMRERLQEVRARLGE-PMRHSESL-QWKEHC 291

  Fly   279 LNHQDDVKQLNKLIDKYNLIVPILENQFFRLHLDRMAEPIF---------KDPELQRNVIRPEMK 334
            ....:::.:|||.:|.:|||||::..|.....|.|..|.|.         |:.|.:||. :.:|:
Zfish   292 AVFAEELAKLNKKVDNFNLIVPLMSRQMVHYSLTRELEKILKTDLLLRQEKEREKERNE-KEQME 355

  Fly   335 SKPSSNLENQG 345
            :...|....||
Zfish   356 TTEMSQHTRQG 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43322NP_609092.1 DnaJ 29..84 CDD:197617 21/62 (34%)
PLN03085 <168..313 CDD:215566 61/145 (42%)
DUF1992 181..250 CDD:286440 38/69 (55%)
dnajc28NP_001017648.1 DnaJ 42..91 CDD:197617 18/49 (37%)
DUF1992 197..265 CDD:286440 38/69 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280530548
eggNOG 1 0.900 E1_KOG0568
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H9869
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007359
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133310
Panther 1 1.100 LDO PTHR24016
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.