DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43322 and DNAJC28

Sequence 1:NP_609092.1 Gene:CG43322 FlyBaseID:FBgn0263027 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001035282.1 Gene:DNAJC28 HGNCID:1297 Length:388 Species:Homo sapiens

Alignment Length:339 Identity:129/340 (38%)
Similarity:193/340 (57%) Gaps:37/340 (11%)


  Fly    23 KRKEVYMECFRILGVHESADQNTVRHAYLDLVKRVHPDSGTEEASAERFQQVDEAFR-----VLQ 82
            |.|:...|.:|:|.|.|....:.||.::..|.|:.|||||:..|.:..|.::::|:|     |::
Human    44 KSKKKIREYYRLLNVEEGCSADEVRESFHKLAKQYHPDSGSNTADSATFIRIEKAYRKVLSHVIE 108

  Fly    83 EKFAKGRRNIQEDEEGAMEFDIKHTAPQHRQYLSNEGIGVGTPFQRQKQYQQVRAMKAQERVLEH 147
            :..|...:.  |:||...:|  |:..||||.|||.||||.|||.||:|.|:|.||.:|.|:|:|:
Human   109 QTNASQSKG--EEEEDVEKF--KYKTPQHRHYLSFEGIGFGTPTQREKHYRQFRADRAAEQVMEY 169

  Fly   148 RIDKAAAGEKTLMSKGGSHFRKHAI----------KTKYGIDRVVEDLIQEAMSKGDFNNLNGSG 202
            :..|       |.|:   :|....|          |....|:|:|||||||:|:||||:||:|.|
Human   170 QKQK-------LQSQ---YFPDSVIVKNIRQSKQQKITQAIERLVEDLIQESMAKGDFDNLSGKG 224

  Fly   203 KPLSSAQSQNPYLDFTTHKLNKIMLDNGFTPEWISLGKDIRDAIAQLKTKLRQERKYYGEWPLQR 267
            |||... |...|:|..||.||:|::|||:.||||...|:|.|.|.||:..:...||..|. |: .
Human   225 KPLKKF-SDCSYIDPMTHNLNRILIDNGYQPEWILKQKEISDTIEQLREAILVSRKKLGN-PM-T 286

  Fly   268 PDDLAAWKIFTLNHQDDVKQLNKLIDKYNLIVPILENQFFRLHLDRMAEPIFKDPELQRNVIR-P 331
            |.:...|.......|:::::|||.|:.:|||||||..|  ::|.|...| |.:..::...:|: .
Human   287 PTEKKQWNHVCEQFQENIRKLNKRINDFNLIVPILTRQ--KVHFDAQKE-IVRAQKIYETLIKTK 348

  Fly   332 EMKSKPSSNLENQG 345
            |:..:..:||: ||
Human   349 EVTDRNPNNLD-QG 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43322NP_609092.1 DnaJ 29..84 CDD:197617 19/60 (32%)
PLN03085 <168..313 CDD:215566 65/155 (42%)
DUF1992 181..250 CDD:286440 40/69 (58%)
DNAJC28NP_001035282.1 DnaJ 51..104 CDD:99751 18/53 (34%)
PLN03085 <200..338 CDD:215566 65/144 (45%)
DUF1992 203..271 CDD:286440 40/69 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280529455
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H9869
Inparanoid 1 1.050 198 1.000 Inparanoid score I3743
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007359
OrthoInspector 1 1.000 T1074434
orthoMCL 1 0.900 OOG5_133310
Panther 1 1.100 LDO PTHR24016
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5522
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.890

Return to query results.
Submit another query.