DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43322 and dnajc28

Sequence 1:NP_609092.1 Gene:CG43322 FlyBaseID:FBgn0263027 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001015977.1 Gene:dnajc28 XenbaseID:XB-GENE-975324 Length:376 Species:Xenopus tropicalis

Alignment Length:330 Identity:128/331 (39%)
Similarity:194/331 (59%) Gaps:17/331 (5%)


  Fly    22 LKRKEVYMECFRILGVHESADQNTVRHAYLDLVKRVHPDSGTEEASAERFQQVDEAFRVL---QE 83
            :|.:....:|:|||.|.|......|||:|..|.|:.|||||:..|::.:|.::|||::.|   .:
 Frog    39 IKYRRNIKDCYRILDVPEGCSVEEVRHSYRCLAKKYHPDSGSVSANSGKFMEIDEAYKALLTHLD 103

  Fly    84 KFAKGRRNIQEDEEGAMEFDIKHTAPQHRQYLSNEGIGVGTPFQRQKQYQQVRAMKAQERVLEHR 148
            |.|| :...|::||...|:.:    ||||.|||.||:|.|||.||:|||.|.|..:|.::|||.|
 Frog   104 KEAK-KGEGQDNEETQTEYKV----PQHRHYLSFEGVGYGTPSQREKQYTQFRVDRATDQVLEFR 163

  Fly   149 IDKAAA--GEKTLMSKGGSHFRKHAIKTKYGIDRVVEDLIQEAMSKGDFNNLNGSGKPLSSAQSQ 211
            ..|...  .|.:|::|.....:|  :|....|:|:|||||||:|:||||:||:|.||||:.. |.
 Frog   164 KQKLERQYTENSLVAKDVRQSKK--VKITQAIERLVEDLIQESMAKGDFDNLSGKGKPLNKF-SY 225

  Fly   212 NPYLDFTTHKLNKIMLDNGFTPEWISLGKDIRDAIAQLKTKLRQERKYYGEWPLQRPDDLAAWKI 276
            .|::|..||.||:|:::||:.||||.|.|:||:.|..|:.|:...|...|: |: .|.....|:.
 Frog   226 CPHIDPMTHNLNRILIENGYQPEWILLQKEIRETIGTLRNKVLASRAKLGD-PM-TPQKRKQWEE 288

  Fly   277 FTLNHQDDVKQLNKLIDKYNLIVPILENQFFRLHLDRMAEPIFKDPELQRNVIR--PEMKSKPSS 339
            .....::|:.:|||.|:.:||:||:|..|....:..|......|....||..:|  .|:::....
 Frog   289 TCDEFKEDIMKLNKRINDFNLVVPLLNRQMVHFNAAREISQAEKTYASQRETVRKAEEIEADRIE 353

  Fly   340 NLENQ 344
            .|::|
 Frog   354 ELKDQ 358

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43322NP_609092.1 DnaJ 29..84 CDD:197617 23/58 (40%)
PLN03085 <168..313 CDD:215566 60/145 (41%)
DUF1992 181..250 CDD:286440 39/69 (57%)
dnajc28NP_001015977.1 DnaJ 46..98 CDD:197617 22/52 (42%)
PLN03085 <140..331 CDD:215566 78/196 (40%)
DUF1992 196..264 CDD:286440 39/69 (57%)
PH-like <309..359 CDD:302622 13/51 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280525613
eggNOG 1 0.900 E1_KOG0568
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H9869
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007359
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.710

Return to query results.
Submit another query.