DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43322 and Dnajc28

Sequence 1:NP_609092.1 Gene:CG43322 FlyBaseID:FBgn0263027 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001014146.1 Gene:Dnajc28 RGDID:1359589 Length:383 Species:Rattus norvegicus

Alignment Length:336 Identity:133/337 (39%)
Similarity:195/337 (58%) Gaps:20/337 (6%)


  Fly    18 RLLHLKRKEVYMECFRILGVHESADQNTVRHAYLDLVKRVHPDSGTEEASAERFQQVDEAFR-VL 81
            |::...:.:...|.:|:|.::|....:.:|.|:..|.|:.|||||:.:|.:..|.:::||:| ||
  Rat    36 RMISTHKPKELSEYYRLLNLNEGCSADNIREAFHRLAKQYHPDSGSADADSATFIKIEEAYRNVL 100

  Fly    82 QE--KFAKGRRNIQED-EEGAMEFDIKHTAPQHRQYLSNEGIGVGTPFQRQKQYQQVRAMKAQER 143
            ..  |..:.|:|..|| ||.|.:|  |:..||||.|||.||:|.|||.||:|||:|.||.:|.|:
  Rat   101 SHVIKQMQARQNKAEDAEEEAEKF--KYNTPQHRHYLSFEGVGFGTPSQREKQYRQFRADRATEQ 163

  Fly   144 VLEHRIDKAA----AGEKTLMSKGGSHFRKHAIKTKYGIDRVVEDLIQEAMSKGDFNNLNGSGKP 204
            |:|::..|..    |...|:...    ::....|....:||:|||||||:|:||||:||:|.|||
  Rat   164 VMEYQRQKLQREYFANSITVKDV----WQSKQQKITQAMDRLVEDLIQESMAKGDFDNLSGKGKP 224

  Fly   205 LSSAQSQNPYLDFTTHKLNKIMLDNGFTPEWISLGKDIRDAIAQLKTKLRQERKYYGEWPLQRPD 269
            |... |...|:|..||.||:|::|||:.||||.:.|:|:|.|.||:..|...||..|. ||. |.
  Rat   225 LKKF-SGCSYIDPMTHNLNRILIDNGYQPEWILMQKEIKDTIEQLREGLLVSRKKLGS-PLS-PV 286

  Fly   270 DLAAWKIFTLNHQDDVKQLNKLIDKYNLIVPILENQFFRLHLDRMAEPIFKDPELQRNVIRPEMK 334
            ....|.......|:|:::|||.|..:|||||||..|  ::|.|...| |.:..|:.|..|..:..
  Rat   287 GQKQWTHVCEQFQEDIRKLNKRISDFNLIVPILTRQ--KVHFDAQKE-ITRVQEIYRAFIEAKEV 348

  Fly   335 SKPSSNLENQG 345
            ::......:||
  Rat   349 AEDKQTDISQG 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43322NP_609092.1 DnaJ 29..84 CDD:197617 20/58 (34%)
PLN03085 <168..313 CDD:215566 67/145 (46%)
DUF1992 181..250 CDD:286440 40/69 (58%)
Dnajc28NP_001014146.1 DnaJ 48..101 CDD:99751 20/53 (38%)
DUF1992 201..269 CDD:286440 40/69 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280527300
eggNOG 1 0.900 E1_KOG0568
Hieranoid 1 1.000
Homologene 1 1.000 H9869
Inparanoid 1 1.050 208 1.000 Inparanoid score I3570
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007359
OrthoInspector 1 1.000 T1088076
orthoMCL 1 0.900 OOG5_133310
Panther 1 1.100 LDO PTHR24016
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
1110.800

Return to query results.
Submit another query.