DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43322 and cog4

Sequence 1:NP_609092.1 Gene:CG43322 FlyBaseID:FBgn0263027 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_588155.1 Gene:cog4 PomBaseID:SPCC338.13 Length:738 Species:Schizosaccharomyces pombe

Alignment Length:341 Identity:58/342 (17%)
Similarity:116/342 (34%) Gaps:125/342 (37%)


  Fly    69 ERFQQVDEAFRVLQEKFAKGRRNIQE--------DEEGAM----EFDIK---------------- 105
            |....:..|...|.:|:.|.:..|..        |.:|::    .||::                
pombe   245 EHVASIIRAHTPLVQKYYKAKNTITVIEKLQGDCDRQGSIIVNTMFDVRRIDNLVSSIASYKYIL 309

  Fly   106 -HTAPQHRQYLSNEGIGVGTPFQRQKQYQQVRAMKAQERVLEHRIDKAAAGEKTLMSKGGSHFRK 169
             |...::|.::|:           ||:.::| :::....:|..            ||        
pombe   310 LHAKLKNRAFVSD-----------QKELERV-SLQTLHPILNE------------MS-------- 342

  Fly   170 HAIKTKYGIDRVVEDLIQEAMSKGDFNNLNGSGKPLSSAQSQNPYLD--------FTTHKLNKIM 226
             ||.:|:.|.::....:...:|:.|             ..|.:|.:.        |.:.|: :::
pombe   343 -AIVSKWNISKIFISRLVLRLSQSD-------------GTSNDPSVQDNLICASIFNSSKM-ELL 392

  Fly   227 LDNGFTPEWISLGKDIRDAIAQLKTKLRQERKYY---GEWPLQRPDDLA-------AWKIFTLNH 281
            |.....|..:.|  :.......::|.|..| :||   ..|.....||:.       ....||::.
pombe   393 LKKQLLPSLLQL--ETYYFRRSIETSLELE-EYYTKVSPWMSSIVDDVMYVTKQVFQRAFFTVSS 454

  Fly   282 QDDVKQLNKLIDKYNLIVPILENQFFRLHLDRMAEPIFKDPELQR--NVIRPEMK------SKPS 338
            ....:.:|:      .::|||.|.::          ::....|..  |:|:.:.:      |.|:
pombe   455 LFFTRFVNE------SLIPILRNDYY----------VYLSHNLLTVCNIIKAQFQRLKNANSIPA 503

  Fly   339 SNLENQ----GSASTS 350
            ..:||.    .|||.|
pombe   504 KQVENYITLVNSASLS 519

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43322NP_609092.1 DnaJ 29..84 CDD:197617 3/15 (20%)
PLN03085 <168..313 CDD:215566 28/163 (17%)
DUF1992 181..250 CDD:286440 9/77 (12%)
cog4NP_588155.1 Cog4 163..481 CDD:214809 47/302 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24016
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.