DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43322 and Dnajc28

Sequence 1:NP_609092.1 Gene:CG43322 FlyBaseID:FBgn0263027 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001093208.1 Gene:Dnajc28 MGIID:2181053 Length:409 Species:Mus musculus

Alignment Length:340 Identity:126/341 (37%)
Similarity:192/341 (56%) Gaps:23/341 (7%)


  Fly    18 RLLHLKRKEVYMECFRILGVHESADQNTVRHAYLDLVKRVHPDSGTEEASAERFQQVDEAFR-VL 81
            |::.....:...|.:|:|.:.|....:.||.::..|.::.|||||:.:|.:..|.:::||:| ||
Mouse    60 RMISTHESQKLREYYRLLNLDEGCSVDDVRESFHKLARQYHPDSGSSDADSATFIKIEEAYRNVL 124

  Fly    82 Q---EKFAKGRRNIQEDEEGAMEFDIKHTAPQHRQYLSNEGIGVGTPFQRQKQYQQVRAMKAQER 143
            .   ::...|:...::..|...|...|:..||||.|||.||:|.|||.||:|||:|.||.:|.|:
Mouse   125 SHAIKRMHAGQDKAEDAAEDEEEGKFKYNTPQHRHYLSFEGVGFGTPSQREKQYRQFRADRATEQ 189

  Fly   144 VLEHRIDKAA----AGEKTLMSKGGSHFRKHAIKTKYGIDRVVEDLIQEAMSKGDFNNLNGSGKP 204
            |:|::..|..    |...|:.....|..:    |....|:|:|||||||:|:||||:||:|.|||
Mouse   190 VMEYQRQKLQREFFANSITVKDVRQSKQQ----KITQAIERLVEDLIQESMAKGDFDNLSGKGKP 250

  Fly   205 LSSAQSQNPYLDFTTHKLNKIMLDNGFTPEWISLGKDIRDAIAQLKTKLRQERKYYGEWPLQRPD 269
            |... |...|:|..||.||:|::|||:.||||.:.|:|:|.|.||:..|...||..|. ||. |.
Mouse   251 LKKF-SGCSYIDPMTHNLNRILIDNGYQPEWILMQKEIKDTIEQLREALLMSRKKLGN-PLS-PT 312

  Fly   270 DLAAWKIFTLNHQDDVKQLNKLIDKYNLIVPILENQFFRLHLDRMAEPIFKDPEL-----QRNVI 329
            :...|.......|:.:::|||.|:.:|||||||..|  ::|.|...| |.:..|:     :.|.:
Mouse   313 EQKQWAQVCEQFQEKIRKLNKRINDFNLIVPILTRQ--KVHFDAQKE-IIRVQEMYGAFVEANEV 374

  Fly   330 RPEMKSKPSSNLENQ 344
            ..|.::..|...|::
Mouse   375 TEENQTDVSQGEESK 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43322NP_609092.1 DnaJ 29..84 CDD:197617 19/59 (32%)
PLN03085 <168..313 CDD:215566 66/145 (46%)
DUF1992 181..250 CDD:286440 40/69 (58%)
Dnajc28NP_001093208.1 DnaJ 72..132 CDD:278647 19/60 (32%)
PLN03085 <224..362 CDD:215566 67/144 (47%)
DUF1992 227..295 CDD:286440 40/69 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280529115
eggNOG 1 0.900 E1_KOG0568
Hieranoid 1 1.000
Homologene 1 1.000 H9869
Inparanoid 1 1.050 201 1.000 Inparanoid score I3748
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007359
OrthoInspector 1 1.000 T1084530
orthoMCL 1 0.900 OOG5_133310
Panther 1 1.100 LDO PTHR24016
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5522
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.