DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmgcl and LEU4

DIOPT Version :8

Sequence 1:NP_001285696.1 Gene:Hmgcl / 33978 FlyBaseID:FBgn0031877 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_014295.1 Gene:LEU4 / 855619 SGDID:S000005048 Length:619 Species:Saccharomyces cerevisiae

Alignment Length:301 Identity:58/302 (19%)
Similarity:97/302 (32%) Gaps:70/302 (23%)


  Fly    34 RDGLQNEPKLLPAATKIELINQLSETGLRTIEA-------TSF-------------VSAKWVPQM 78
            |||.|:.|..:....|.|..::|...|.:.||.       |.|             ||.:.:.|.
Yeast    69 RDGNQSLPDPMSVEQKKEYFHKLVNIGFKEIEVSFPSASQTDFDFTRYAVENAPDDVSIQCLVQS 133

  Fly    79 GDN-----AEVLKGIRKVTGISYPVLTPNLKGFESALEAGAEEVAVFGAASDAFSLKNVNCTAAE 138
            .::     .|.|.|.:|.|                        :..:.|.||.|.....|.:..|
Yeast   134 REHLIKRTVEALTGAKKAT------------------------IHTYLATSDMFREIVFNMSREE 174

  Fly   139 AIERFKPVLKAAQK------HGVRVRGYVSTVVGC----PYEGAVAPSAVVKVVEALYQMGCYEI 193
            ||.:.....|..:|      .....|........|    |.|.||.....||......:......
Yeast   175 AISKAVEATKLVRKLTKDDPSQQATRWSYEFSPECFSDTPGEFAVEICEAVKKAWEPTEENPIIF 239

  Fly   194 SLGDTIGVGTPGTMRRMLDEVTKVVPAKD---LAVHCHDTYGQALSNILVSLDYGIRVVDSSVSG 255
            :|..|:.|.:|......::.....:..::   ::.|||:..|..::...:.:..|...|:     
Yeast   240 NLPATVEVASPNVYADQIEYFATHITEREKVCISTHCHNDRGCGVAATELGMLAGADRVE----- 299

  Fly   256 LGGCPYAKG-ASGNAATEDVVYLLHGMGLDTGVNLDKLIQV 295
              ||.:..| .:||.....|...::..|:...::...|..|
Yeast   300 --GCLFGNGERTGNVDLVTVAMNMYTQGVSPNLDFSDLTSV 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HmgclNP_001285696.1 HMGL-like 25..299 CDD:279072 58/302 (19%)
DRE_TIM_HMGL 28..300 CDD:163676 58/302 (19%)
LEU4NP_014295.1 leuA_yeast 35..596 CDD:273371 58/302 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116729
eggNOG 1 0.900 E1_COG0119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.