DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmgcl and LEU9

DIOPT Version :8

Sequence 1:NP_001285696.1 Gene:Hmgcl / 33978 FlyBaseID:FBgn0031877 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_014751.1 Gene:LEU9 / 854275 SGDID:S000005634 Length:604 Species:Saccharomyces cerevisiae

Alignment Length:291 Identity:59/292 (20%)
Similarity:106/292 (36%) Gaps:32/292 (11%)


  Fly    34 RDGLQNEPKLLPAATKIELINQLSETGLRTIEATSFVSAK-----WVPQMGDNAEVLKGIRKVTG 93
            |||.|:.|..:..|.|.|..::|...|.:.|| .||.||.     :.....:||....||:.:..
Yeast    68 RDGNQSLPDPMSVAQKKEYFHKLINIGFKEIE-VSFPSASQTDFDFTRYAVENAPDDVGIQCLVQ 131

  Fly    94 ISYPVLTPNLKGFESALEAGAEEVAVFGAASDAFSLKNVNCTAAEAIERFKPVLKAAQK------ 152
            ....::...::....|..|   .:..:.|.||.|.....|.:..|||.:.....|..:|      
Yeast   132 SREHLIKRTVEALTGAKRA---TIHTYLATSDMFREIVFNMSREEAISKAVEATKLVRKLTKDDP 193

  Fly   153 HGVRVRGYVSTVVGC----PYEGAVAPSAVVKVVEALYQMGCYEISLGDTIGVGTPGTMRRMLDE 213
            .....|........|    |.|.||.....||......:......:|..|:.|.:|......::.
Yeast   194 SQQATRWSYEFSPECFSDTPGEFAVEICEAVKKAWEPTEENPIIFNLPATVEVASPNVYADQIEY 258

  Fly   214 VTKVVPAKD---LAVHCHDTYGQALSNILVSLDYGIRVVDSSVSGLGGCPYAKG-ASGNAATEDV 274
            .:..:..::   ::.|||:..|..::...:.:..|...|:       ||.:..| .:||.....|
Yeast   259 FSTHITEREKVCISTHCHNDRGCGVAATELGMLAGADRVE-------GCLFGNGERTGNVDLVTV 316

  Fly   275 VYLLHGMGLDTGVNLDKLIQVGRYI--CTEL 303
            ...::..|:...::...|..:...:  |.::
Yeast   317 AMNMYTQGVSPNLDFSDLTSISEIVHRCNKI 347

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HmgclNP_001285696.1 HMGL-like 25..299 CDD:279072 58/284 (20%)
DRE_TIM_HMGL 28..300 CDD:163676 58/287 (20%)
LEU9NP_014751.1 leuA_yeast 34..596 CDD:273371 59/292 (20%)
DRE_TIM_LeuA 59..343 CDD:163680 58/286 (20%)
LeuA_dimer 455..594 CDD:214910
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116622
eggNOG 1 0.900 E1_COG0119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.