DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac1 and zzz3

DIOPT Version :8

Sequence 1:NP_609088.1 Gene:Atac1 / 33977 FlyBaseID:FBgn0031876 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001093497.1 Gene:zzz3 / 567022 ZFINID:ZDB-GENE-030131-6450 Length:871 Species:Danio rerio

Alignment Length:401 Identity:129/402 (32%)
Similarity:184/402 (46%) Gaps:90/402 (22%)


  Fly     5 EISAEDEDVFHFETEHLALRGNQCYTNLLRTLAVLQAQRIRVHQQIEELEATQNIYLENPQHMLD 69
            |...||.||::||::||||:.|:.|..||:|::||:|||.:....:|.|...|...|.:|...:|
Zfish   444 EEEEEDPDVYYFESDHLALKHNKDYQRLLQTISVLEAQRTQAILDLETLARHQKEALSDPIAFVD 508

  Fly    70 KLRNNE-------------PLIA-DNYIT------------------------TTVLPDLPTLSP 96
            :|:...             |.|| |.|.:                        ...||..|. ||
Zfish   509 QLQKQVDMGLPRPQRVVQLPEIAWDQYTSGRGDFEREFCDKKRKTRQLQLIFDKVGLPARPK-SP 572

  Fly    97 NDEEGGTNETPTDASSWTQEANKNRDRSNGRS-------------ENFNRLWTNEEQSRLEQLLI 148
            .|.:.....:...:||...........|:.|:             :.||:|||.|||.:|||||:
Zfish   573 VDSKKEGESSSIYSSSLPSSDGPEHSMSSSRAQMIRGRLCNQSKPDTFNQLWTIEEQKKLEQLLL 637

  Fly   149 QYPPEEVEMRRFGKIAKALGNRTAQQVYSRVQKYFQKLHDAGMPVPGRIPK---HRRPGLSKPKI 210
            ::||||||.:|:.|||..||||||:||.|||||||.||..||:|||||.|.   :.:...||.:.
Zfish   638 KFPPEEVESKRWQKIADELGNRTAKQVASRVQKYFIKLTKAGIPVPGRTPNVCMYSKKASSKRQH 702

  Fly   211 KLRK-----STFFPAHNISLQMPEDD---FTFDDLRIPS-PASDMLLMPASKIEPKIESEYMDAD 266
            .|.|     |||..::...:.|.::|   ..|:.|:..| ..||...:|   :|.:...||.:. 
Zfish   703 HLNKHLYRPSTFLTSYEPPVYMDDEDERSHFFNSLQDNSADDSDEDGVP---VELRHLPEYKEL- 763

  Fly   267 LNAESKRKQELC-LKLLSAIQDEKREMEDGYEPDLLAAKCAECEEASVTRTQWRCNSC------- 323
            |..:..:||:|. |:..||:....     ||       ||..|....:...:|.|..|       
Zfish   764 LELKKLKKQKLHELQAESALTQHV-----GY-------KCDICGMEPIQGVRWHCQDCPQDNAVD 816

  Fly   324 YCYLNLCGDCL 334
            :|  :.|.|||
Zfish   817 FC--STCSDCL 825

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atac1NP_609088.1 SANT 135..185 CDD:197842 35/50 (70%)
SANT 135..183 CDD:238096 34/48 (71%)
zzz3NP_001093497.1 SANT 624..674 CDD:197842 35/50 (70%)
Myb_DNA-binding 624..671 CDD:278669 33/47 (70%)
ZZ 789..839 CDD:294208 12/47 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C323096669
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H9182
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007608
OrthoInspector 1 1.000 T1053712
orthoMCL 1 0.900 OOG5_135442
Panther 1 1.100 LDO PTHR22705
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5523
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.