DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac1 and Zzz3

DIOPT Version :8

Sequence 1:NP_609088.1 Gene:Atac1 / 33977 FlyBaseID:FBgn0031876 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001128021.2 Gene:Zzz3 / 310958 RGDID:1565468 Length:909 Species:Rattus norvegicus

Alignment Length:422 Identity:130/423 (31%)
Similarity:193/423 (46%) Gaps:104/423 (25%)


  Fly     4 AEISAEDEDVFHFETEHLALRGNQCYTNLLRTLAVLQAQRIRVHQQIEELEATQNIYLENPQHML 68
            ||...:|.||::||::|:||:.|:.|..||:|:|||:|||.:..|.:|.|...|...|:||...:
  Rat   484 AEEEDDDPDVYYFESDHVALKHNKDYQRLLQTIAVLEAQRSQAVQDLESLGKHQREALKNPIGFV 548

  Fly    69 DKLRNN--------------EPLIADNYITT------------------------TVLPDLPTLS 95
            :||:..              ..::.|.|.::                        ..||..|. |
  Rat   549 EKLQKKADIGLPYPQRVVQLPEIVWDQYTSSLGNFEREFKHRKRHTRRVKLVFDKVGLPARPK-S 612

  Fly    96 PND--EEGGTNETPTDASSWTQ-------EANKNRDR-------SNGRSENFNRLWTNEEQSRLE 144
            |.|  ::|       |:.|::.       |.:.:|.:       .:.:.|.||:|||.|||.:||
  Rat   613 PLDPKKDG-------DSLSYSMLPLSDGPEGSHHRPQMIRGRLCDDSKPETFNQLWTVEEQKKLE 670

  Fly   145 QLLIQYPPEEVEMRRFGKIAKALGNRTAQQVYSRVQKYFQKLHDAGMPVPGRIPK----HRRPGL 205
            |||::|||||||.||:.|||..||||||:||.|||||||.||..||:|||||.|.    .|:...
  Rat   671 QLLLKYPPEEVESRRWQKIADELGNRTAKQVASRVQKYFIKLTKAGIPVPGRTPNLYIYSRKSST 735

  Fly   206 SKPKIKLRK-----STFFPAHNISLQMPEDDFTFDDLRIPSPASDMLLMPASKIEPKIESEYMDA 265
            |:.:..|.|     |||..:|...:.|.|||      ....|.|.|    ::.:|...:.|.:..
  Rat   736 SRRQHPLNKHLFKPSTFMTSHEPPVYMDEDD------ERSCPHSHM----STAVEEASDEESIPV 790

  Fly   266 DLNAESKRKQELCLKLLSAIQDEKREMEDGYEPDLLAAKCAECEEASVTRTQWRCNSC------- 323
            ...:..:.|:.|..|.|...:.::.:.|.|:... :..||..|....:...:|.|..|       
  Rat   791 IYRSLPEYKELLQFKKLKKQKLQQMQAESGFVQH-VGFKCDNCGVEPIQGVRWHCQDCPPEMSLD 854

  Fly   324 YCYLNLCGDCLASQLIEGRFEHLSHEVVVDQE 355
            :|  :.|.||             .||..:.:|
  Rat   855 FC--DSCSDC-------------PHETDIHKE 871

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atac1NP_609088.1 SANT 135..185 CDD:197842 37/50 (74%)
SANT 135..183 CDD:238096 36/48 (75%)
Zzz3NP_001128021.2 SANT 661..711 CDD:197842 37/50 (74%)
Myb_DNA-binding 661..708 CDD:278669 35/47 (74%)
ZZ_ZZZ3 827..877 CDD:239081 13/61 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C323096775
eggNOG 1 0.900 E1_KOG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H9182
Inparanoid 1 1.050 128 1.000 Inparanoid score I4510
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007608
OrthoInspector 1 1.000 T1088080
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR22705
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.980

Return to query results.
Submit another query.