DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac1 and dnj-11

DIOPT Version :8

Sequence 1:NP_609088.1 Gene:Atac1 / 33977 FlyBaseID:FBgn0031876 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_501006.1 Gene:dnj-11 / 177419 WormBaseID:WBGene00001029 Length:589 Species:Caenorhabditis elegans

Alignment Length:314 Identity:63/315 (20%)
Similarity:101/315 (32%) Gaps:95/315 (30%)


  Fly    45 RVHQQIEELEATQNIYLENPQHMLDKLRNNEPLIADNYITTTVLPDL------PTLSPNDEEGGT 103
            :.::|:...:..:..: ::..|..:.:..||..|..|.....:.|..      ..:.|..|.|.:
 Worm   151 KAYEQVGMSDVKRQAF-DSVDHKFNDIIPNEKSINHNNFYNELAPVFQLNSRWSNIKPVPELGKS 214

  Fly   104 NETPTDASSWTQEANKNRDRSNGRSENFNRLWTN----EEQSRLEQLLIQYPPEEVEMRRFGKIA 164
            :.|..|.                  |||...|.|    .|.|.|::...:...:..|.|...|..
 Worm   215 DATREDV------------------ENFYDFWFNFQSWREFSYLDEEDKERGEDRYERREMEKQN 261

  Fly   165 KALGNRTAQQVYSRVQKYFQKLHDAGMPVPGRIPKHRRPGLSKPKIKLRKSTFFPAHNISLQMPE 229
            ||...|..::...|:    :||.|.......||            ||.:|.          |..:
 Worm   262 KAERERRRKEEAKRI----RKLVDIAYAKDPRI------------IKFKKE----------QQAK 300

  Fly   230 DDFTFDD----LRIPSPASDMLLMPASKIEPKIESEYMDADLNAESKRKQE-----LCLKLLSAI 285
            .|...:|    :|....|.|.......:.|.|.:.|   ||..|:.:|::|     :..|.:|  
 Worm   301 KDKAKEDKQRAIREKQEAIDREKREKEEAEAKQKEE---ADRKAKEEREREKKERDIAKKAMS-- 360

  Fly   286 QDEKR--------------------EMED------GYEPDLLAAKCAECEEASV 313
            |..||                    |||.      |:..|.|...|.:.|..|:
 Worm   361 QQRKRLKKLADEAGHWTENPRDKLTEMERIERICIGFTVDQLRELCEKVESLSI 414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atac1NP_609088.1 SANT 135..185 CDD:197842 12/54 (22%)
SANT 135..183 CDD:238096 12/52 (23%)
dnj-11NP_501006.1 ZUO1 61..441 CDD:227594 63/315 (20%)
DnaJ 98..167 CDD:278647 1/17 (6%)
SANT 455..509 CDD:238096
SANT 536..584 CDD:197842
SANT 536..582 CDD:238096
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.