DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13775 and K09A11.1

Sequence 1:NP_001285694.1 Gene:CG13775 FlyBaseID:FBgn0031874 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_510202.2 Gene:K09A11.1 WormBaseID:WBGene00010704 Length:605 Species:Caenorhabditis elegans

Alignment Length:673 Identity:133/674 (20%)
Similarity:253/674 (38%) Gaps:158/674 (23%)


  Fly     5 KSNVWQYFYKTSGTVATCLLCNRNYSRRGRGTT-CLRNHLKSKHPPEFLSLSGDIKYLDLVKSEI 68
            ||.||.||.|.......|.|||:..:|..||:| .|.:||...||.|:           :::.| 
 Worm     3 KSRVWDYFLKLQDGRNKCNLCNKILARGSRGSTHNLISHLTRVHPKEY-----------VLQEE- 55

  Fly    69 SIGSPQHPTAQLELNLHETDSDPLDTEDISYSKRCDEKLALMLLNHS------FEFI-------- 119
                |....||.:.:.....|:.:.|||.:.....:.:. :.|.|.:      .|.|        
 Worm    56 ----PPVMIAQEDSSEFSFQSNNMKTEDFTMQSFFEPEF-MKLYNDNNITKSIMEMICMDSMPMT 115

  Fly   120 --EGPGFVNFIRTLQPRYTIQPRSYYEKILCEDIQRKMHQHLKQQVDLLDAISLSTSLWRGDKGE 182
              :..||..|:.::.|.|.::..|.........:.::....|:.:::|.:.:.||..:| .|||.
 Worm   116 TTDRAGFKRFMTSVCPDYELKSPSSMISYELPKLYQEYEDQLRMELNLAEHVVLSVDIW-SDKGS 179

  Fly   183 GLLSLSCSGISRDFQTHRLMLK--CEALNYESTSKLACCIRDLVPSL--------AIEVPKEKIH 237
               .....|::.:|..:..:::  ...:||:........:...:.:|        .:||.....:
 Worm   180 ---IQEMIGVTGNFLKNEKVVRRTIGVINYQKDVHNGVYVAAELDNLMARFNLNGKVEVVCRDYN 241

  Fly   238 CVIRDEMTALPGSLPDCSVHRLQMCVRFAL----QSNELLQNLSSKCKQIVDHFASSKM---AND 295
            .::.:....|..|..:|...:|.:....|.    |.|.:|.|    ||.:|.:..:|.:   .::
 Worm   242 SIVENACDHLKISSVNCFNQQLHLAACEAKSKIGQINRVLLN----CKLLVKNLKNSSVTWQTSE 302

  Fly   296 HLKFIQEI-RLTRDPCTLTPYDPCQWNSAFQMMSSVFRMKDALSLYCEEYSLVQIYPDEWIEIDL 359
            .::.:.|| .|..:.|:    |.| |....:....|...:..:    ||  |.::...:|   ||
 Worm   303 KIQSLMEIPNLCLNHCS----DEC-WCFLQEFFGRVIECQQVI----EE--LQKLQSSDW---DL 353

  Fly   360 CSKVMQ---PCEETIKIWSNPSTTTSSVIP----LV-------------AALRDSLRTDVHNFVS 404
            ...|::   |..:..|:..:..::.|.:||    ||             .|:::.:..::|.:.|
 Worm   354 MRDVVEILAPLSKFSKLSESKESSASVIIPYCDYLVKAYESTQNQPEAFLAVKEHMERELHKYTS 418

  Fly   405 SVTICSFARKLLEELEMKFAHITSDINFLMATYLDPRYK-------------QAFFTEREEQLVA 456
                |.:         :||           :|.||||||             :|..||.|.....
 Worm   419 ----CQY---------LKF-----------STLLDPRYKDLYTNDSDTSNLIKAIETEFETMDYK 459

  Fly   457 NEVLLQLAGVPEDCNGQPPLKIIKVSSTSSQKNES--KIDSILDSILTTGTTNTQQPNTSMGSQS 519
            |....:::.  |.|...|..:.:...:...:|.:|  |.:::....||.....|:..:|::    
 Worm   460 NRTFEEISS--ELCGPAPKSQKLDFDAYIQEKIKSRGKHNALTGEKLTVRMEVTRYLSTAV---- 518

  Fly   520 QIKNLLYLYNSEPRIDRNMDPLIWWRSNI---KYISLYGIVRKFLSAPAASVVSEGLFRKSTHLY 581
                            .::.|..:|.:::   .|..|....|:|:..|..|..:|.||.......
 Worm   519 ----------------EDVTPRDFWLNDVTKASYPRLAKFARRFIICPTGSSAAEKLFSTDRATM 567

  Fly   582 FDMQAGLSPESASKMLLMKANFS 604
            .:.:..||.|:...::.:..|.|
 Worm   568 DEYRNTLSDENLKMLIFLNKNIS 590

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13775NP_001285694.1 zf-BED 6..48 CDD:280965 18/43 (42%)
Dimer_Tnp_hAT 525..603 CDD:283379 15/81 (19%)
K09A11.1NP_510202.2 ZnF_BED 6..49 CDD:214746 18/43 (42%)
Dimer_Tnp_hAT 509..589 CDD:283379 17/100 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4868623
eggNOG 1 0.900 E1_KOG1121
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S7637
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D223749at2759
OrthoFinder 1 1.000 FOG0002399
OrthoInspector 1 1.000 T375155
orthoMCL 1 0.900 OOG5_130974
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.617 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.560

Return to query results.
Submit another query.