DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13775 and B0545.4

Sequence 1:NP_001285694.1 Gene:CG13775 FlyBaseID:FBgn0031874 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_499862.2 Gene:B0545.4 WormBaseID:WBGene00015247 Length:117 Species:Caenorhabditis elegans

Alignment Length:79 Identity:20/80 (25%)
Similarity:33/80 (41%) Gaps:5/80 (6%)


  Fly   532 PRIDRNMDPLIWWRSNIKYISLYGIVRKFLSAPAASVVSEGLFRKSTHLYFDMQAGLSPESASKM 596
            || |..::||    |...|..|....|:|:..|..|...|.||..:..:....:..|:.|:...:
 Worm    16 PR-DYWLNPL----SKSSYPRLSQFARRFVICPTGSSEVERLFSTAGTILTKYRKTLTSENFKML 75

  Fly   597 LLMKANFSFSNSEI 610
            |.:..|....|.::
 Worm    76 LTLNKNIRLMNPDM 89

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13775NP_001285694.1 zf-BED 6..48 CDD:280965
Dimer_Tnp_hAT 525..603 CDD:283379 19/71 (27%)
B0545.4NP_499862.2 Dimer_Tnp_hAT 2..82 CDD:283379 19/71 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4868599
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D223749at2759
OrthoFinder 1 1.000 FOG0002399
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130974
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.