DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13775 and B0545.4

DIOPT Version :10

Sequence 1:NP_609087.1 Gene:CG13775 / 33975 FlyBaseID:FBgn0031874 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001367375.1 Gene:B0545.4 / 182029 WormBaseID:WBGene00015247 Length:117 Species:Caenorhabditis elegans


Alignment Length:157 Identity:35/157 - (22%)
Similarity:55/157 - (35%) Gaps:44/157 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VNTIRSQGAQMAQKVHRSCRCRA--------AKQGRVSVELTIPIPESIPEPIPIPVSIPESILD 59
            ::|.|.:.:....:...:||..|        |:|....||..||   :.||.:....::......
 Worm    94 LHTARQELSHALYQHDSACRVIARLKKERDEARQLLAEVERHIP---AAPEAVTANAALSNGKRA 155

  Fly    60 LITEPI--------PGPILESISE-PDSGPNI---RNRFQKTAELTGID---------------S 97
            .:.|.:        ||...|.|:| .|....:   |.:.|....|..||               :
 Worm   156 AVDEELGPDAKKLCPGISAEIITELTDCNAALSQKRKKRQIPQTLASIDTLERFTQLSSHPLHKT 220

  Fly    98 DKSFIFPITSIH--DVIGFYGAAGPVD 122
            :|..|..:..:|  |||    |.|.||
 Worm   221 NKPGICSMDILHSKDVI----ATGGVD 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13775NP_609087.1 zf-BED 6..48 CDD:427043 12/49 (24%)
Dimer_Tnp_hAT 525..603 CDD:399013
B0545.4NP_001367375.1 Dimer_Tnp_hAT 2..82 CDD:399013
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.