DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13775 and ZNF618

Sequence 1:NP_001285694.1 Gene:CG13775 FlyBaseID:FBgn0031874 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_005251749.1 Gene:ZNF618 HGNCID:29416 Length:989 Species:Homo sapiens

Alignment Length:400 Identity:89/400 (22%)
Similarity:147/400 (37%) Gaps:115/400 (29%)


  Fly   253 DCSV-----HRLQMCVR-FALQSNELLQNLSSK-----------------CKQIVDHFASSKMAN 294
            ||.|     .:..||:| .|...|.::|::.||                 |:.:.   .|:.:|.
Human   653 DCRVSTSAFSKAGMCLRCSACALNSVVQSVLSKRTLQARSMHEVIELLNVCEDLA---GSTGLAK 714

  Fly   295 DHLKFIQEIRLTRDPCTLTPYDPCQWNSAFQMMSSVFRMKDALSLYCEEYS------LVQIYPDE 353
            :....::|   |..|       || |||   :..|:..:.:.....||.||      |:|.    
Human   715 ETFGSLEE---TSPP-------PC-WNS---VTDSLLLVHERYEQICEFYSRAKKMNLIQS---- 761

  Fly   354 WIEIDLCSK---VMQPCEETIKIWSNPS-TTTSSVIPLVAALRDSLRTDVHNFVSSVT-ICS-FA 412
             :...|.|.   ::.|.::.:...||.| .|...|:|....| :.|.|...|...:|: :|. |.
Human   762 -LNKHLLSNLAAILTPVKQAVIELSNESQPTLQLVLPTYVRL-EKLFTAKANDAGTVSKLCHLFL 824

  Fly   413 RKLLEELEMKFAHITSDINFLMATYLDPRYK-QAFFTEREEQLVA------NEVLLQLAGVPEDC 470
            ..|.|..::..||       .:|..|||:.| :.....:.|:::.      |||....|   |:.
Human   825 EALKENFKVHPAH-------KVAMILDPQQKLRPVPPYQHEEIIGKVCELINEVKESWA---EEA 879

  Fly   471 NGQPPLKIIKVSSTSSQKNESKIDSILDSILTTGTTNTQQPNTSMGSQSQIKNLLYLYNSEPRID 535
            :.:|..|  |..|.:.:...::.|..|.                       ||.:|.|..||...
Human   880 DFEPAAK--KPRSAAVENPAAQEDDRLG-----------------------KNEVYDYLQEPLFQ 919

  Fly   536 RNMDPLIWWRS-NIKYISLYGIVRKFLSAPA-------ASVVSEGLFRKSTHLYFDMQAGLSPES 592
            ...|...:|.. ..|:..|..:....|:.||       .::..:.|..|...|       ||||.
Human   920 ATPDLFQYWSCVTQKHTKLAKLAFWLLAVPAVGARSGCVNMCEQALLIKRRRL-------LSPED 977

  Fly   593 ASKMLLMKAN 602
            .:|::.:|:|
Human   978 MNKLMFLKSN 987

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13775NP_001285694.1 zf-BED 6..48 CDD:280965
Dimer_Tnp_hAT 525..603 CDD:283379 21/86 (24%)
ZNF618XP_005251749.1 C2H2 Zn finger 149..169 CDD:275368
C2H2 Zn finger 190..210 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1121
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.