DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13775 and si:dkeyp-117b8.4

Sequence 1:NP_001285694.1 Gene:CG13775 FlyBaseID:FBgn0031874 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_005165631.1 Gene:si:dkeyp-117b8.4 ZFINID:ZDB-GENE-060526-362 Length:974 Species:Danio rerio

Alignment Length:827 Identity:163/828 (20%)
Similarity:283/828 (34%) Gaps:239/828 (29%)


  Fly     3 KKKSNVWQYFYKTSGTVATCLLCNRNYSRRGRGTTCLRNHLKSKH-------PP----------- 49
            ::.|.||.::.:.|.....|..|.|..|.. ..||.:|.||..||       ||           
Zfish   117 RRTSKVWNHYTQLSLHRVECNHCKRQLSFH-NSTTSMREHLGRKHSIREGVVPPHNTAGIPTPGA 180

  Fly    50 -----------EFLSLSGDIKYLDL----VKSE------ISIG-------------SPQHPTAQL 80
                       ...:.:|::.:..|    ||.|      ..:|             :|...|:..
Zfish   181 LHSHIQSTLHGNRCNNTGNVTFQPLLPVTVKEEHEEILPAEMGEAKAARTSYAPDCAPGSSTSGS 245

  Fly    81 ELNLHETDSD-----------PLDTEDISYSKRCD---------EKLALMLLNHSF------EFI 119
            ....|: |:|           .:.:.....|.||.         |.|..::|...|      ..:
Zfish   246 NAITHQ-DTDMGCLMYNFPAGEMSSTAGGSSSRCGTRACSNKRAEVLTDLILEMVFRDLQPLSVV 309

  Fly   120 EGPGFVNFIRTLQPRYTIQPRSYYEKILCED---IQRKMHQHLKQQVDLLD-AISLSTSLWR--- 177
            |..||...:..|:|.|.:...|....:|...   :::.:.|||  |..|.. .::|.|..||   
Zfish   310 EERGFKLLLSCLEPNYPVPSPSLLGSLLWHRYHVLKQCLQQHL--QTSLASHYMTLCTEYWRSVE 372

  Fly   178 ----GDKGEGLLSLSCSGISRDFQTHRLMLKCE---ALNYESTSKLACCIRDLVPSLAIE--VPK 233
                |..|:..||:|...|...::..|.||:..   .|....:.:......|.:.::..|  :.:
Zfish   373 GCGVGGDGQYYLSVSAHFIDSQWRLARCMLETRPIAELKGNPSERGQVSFADTLKAVLSEFQLSE 437

  Fly   234 EKIHCVIRDEMT--------------ALPG-------SLPD------CSVHRLQMCVRFALQSNE 271
            ..:.||:.|..:              ..||       .||.      |:...|::||:..|....
Zfish   438 NSVFCVMHDTPSDSESRQSIDREFPQEFPGPSHPPPRKLPKGWAPLLCAGQALKLCVQEGLCVES 502

  Fly   272 LLQNLSSKCKQIVDHFASSKMANDHLKFIQEIRLTRDPCTLTPYDPCQWNSAFQMMSSVFRMKDA 336
            :.|.|:. .:.||.||..:..|:..|....| .:.::..:|...||.:|.:|..|..|:..:|..
Zfish   503 VRQALAD-ARAIVLHFQHNVGASTALSQKAE-AVNKESASLVLNDPGRWTTAIDMCESLLELKWV 565

  Fly   337 LSLYCEEYSLVQIYPD-EWIEIDLCSKVMQPCEETIKIWS-----NPSTTTSSVIPLVAALRDSL 395
            :|...||..:.....| :|..:    ..:.|..:|::|.:     :.:...|:::|.:..:...|
Zfish   566 ISSVLEEQKIATNLADHQWRLV----HELVPVLKTVRIAASFLSEDINGPISALMPCLQGVSRLL 626

  Fly   396 RTDVHNFVSSVTICSFARKLLEELE--MKFAHITSDINFL------MATYLDPRYK--------- 443
            ...:.:     ..|...|.::|.:.  |......||.:.|      ::::||||:|         
Zfish   627 GQKIAD-----CTCPVVRGVMERIRAGMDKRWSLSDEDALLDCPAVLSSFLDPRFKELRFLSPHA 686

  Fly   444 --------------QAF-----FTEREEQLVANEVLLQLAGVPEDCNGQPPLKIIKVSSTSS--- 486
                          |||     ..|...|.:..|..|...|.|.|......|.|..:.|..|   
Zfish   687 RSKLHDKVKELLSVQAFTSNEGLNEDRRQRMEMEEALDEHGDPADFGLDDSLPIPPMGSLDSPES 751

  Fly   487 ------------QKNE-----SKIDSILDSILTTGT----TNTQQPNTSMGSQS----------- 519
                        |.:|     |..:.:.|:.|..|:    ||.::..:|..:.:           
Zfish   752 CGSLEEGDSVELQPSELSVAVSSPEQVNDNALEVGSPFKNTNERKRRSSGATMTSPVRGDLQLTS 816

  Fly   520 -------------------------QIKNLLYLYNSEPRIDRNMDPLIWWRS-NIKYISLYGIVR 558
                                     :|...|..|.:||...|::.||.|||| ..::.::..:.|
Zfish   817 RIRMSPLPQSMYDILLGEDPTERMPEIHQQLENYIAEPLCRRSLSPLQWWRSKEHRFPAVARLAR 881

  Fly   559 KFLSAPAASVVSEGLFRKSTHLYFDMQAGLSPESASKMLLMKANFSF 605
            |:||.||.:|.:...|..........:|.|..:..:.:|.:..|..:
Zfish   882 KYLSIPATAVSANRAFAPRESPVTQRRATLGSKHLNHILFLHQNADY 928

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13775NP_001285694.1 zf-BED 6..48 CDD:280965 15/49 (31%)
Dimer_Tnp_hAT 525..603 CDD:283379 23/79 (29%)
si:dkeyp-117b8.4XP_005165631.1 zf-BED 21..63 CDD:280965
zf-BED 120..161 CDD:280965 15/42 (36%)
Dimer_Tnp_hAT 846..925 CDD:283379 22/79 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D223749at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.