DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13775 and si:dkey-13n23.3

Sequence 1:NP_001285694.1 Gene:CG13775 FlyBaseID:FBgn0031874 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_001340716.5 Gene:si:dkey-13n23.3 ZFINID:ZDB-GENE-120214-42 Length:650 Species:Danio rerio

Alignment Length:664 Identity:140/665 (21%)
Similarity:243/665 (37%) Gaps:150/665 (23%)


  Fly     3 KKKSNVWQYF-YKTSGTVATCLLCNRNYSRRGRGTTCLRNHLKSKHPPEFLSLSGDIKYLDLVKS 66
            |::.::|..| |......:.|..|....:  |:.||.|:.||::.||.              :.:
Zfish    15 KRRIDIWSNFTYDNKDNKSVCKPCGVKIA--GKNTTNLKRHLQTAHPE--------------IHT 63

  Fly    67 EISIGSPQH-----------PTAQ-------LELNLHETDSDPLDTEDISYSKRCDEKLALMLLN 113
            :|...|..|           .|.|       |..:.::|:|....|::.:.: |...:..|.|..
Zfish    64 KIQKMSDDHGPGGNKASDATSTTQQQAISDFLRSSKYKTESKEQQTKEQAIA-RWIGRTGLPLTT 127

  Fly   114 HSFEFIEGPGFVNFIRTLQPRYTIQPRSYYEKILCEDIQRKMHQHLKQQVDLLDAISLSTSLW-- 176
                 :|...||..:..:..|.|: |:......|.|.......|..::.:.....:|:...||  
Zfish   128 -----VEDEDFVLMMGMIDGRLTV-PKKTKISNLIETQYEHERQKFRESLAAARKVSIGLDLWTK 186

  Fly   177 RGDKGEGLLSLSCSGISRDFQTHRLMLKCEALNYESTSKL--AC---CIRDLVPSLAIEVPKEKI 236
            :|.....|...:|.......:...::|..:.:.:..|::.  ||   |:::..      :|||||
Zfish   187 KGLTASFLAISACYFCVEKSKPAHILLALQQVGHPHTAQAIKACVDKCMQEWT------IPKEKI 245

  Fly   237 HCVIRD---EMTAL---------------PGSLPD---------------------CSVHRLQMC 262
            ..||.|   .|.|.               |||..:                     |.||.:|:.
Zfish   246 LTVITDNGSNMVAAFKNTTAEETSSEDDSPGSTIESDSEIDDQRYRHVDMELDRTPCVVHTIQLV 310

  Fly   263 VRFALQSNELLQNLSSKCKQIVDHFASSKMANDHLKFIQEIRLTRDPCTLTPYDPC--QWNSAFQ 325
            |.. ||....::.:..|.:.:|..|..|.:|...|         .|.|.:...:.|  :|:|.|.
Zfish   311 VHM-LQKETTVKRVLDKARSVVKLFRKSSVATQKL---------LDQCGVIVVNDCPTRWSSTFN 365

  Fly   326 MMSSVFRMKDALSLYCEEYSLVQIYPDEWIEIDLCSKVMQPCEETIKIWSNPSTTTSSVIPLVAA 390
            |::.:.::|||:.....:.....:...||.::.....::.|..|..|...:.:|:.|.|:|   |
Zfish   366 MITRLLKVKDAVCQISNDMGWDSLLTSEWQKLSSLHDLLLPFAEHTKTLQSDTTSMSLVVP---A 427

  Fly   391 LRDSLRTDVHNFVSSV---TICSFARKLLEELEMKFAHI--TSDINF----LMATYLDPRYKQAF 446
            |.| |.|.:.:|..:.   .:.:.|.|:...|..:||.|  |:|..|    ..|.:::|...:..
Zfish   428 LFD-LLTHLTDFAVNTRYRDLATLADKMRSNLNQRFACILDTTDEKFSPLAAAACFVNPTVCEII 491

  Fly   447 FTEREEQLVANEVLLQLAGVPEDCNGQPPLKIIKVSSTSSQKNESKIDS----------ILDSIL 501
            ....    |||..:.:|....||.    .:|..|....|....|..|:.          :...:.
Zfish   492 VNVD----VANGNIQELLKQAEDY----VVKCTKQEGQSENDEEEVIEEPEAAPSSKQPVFRFLS 548

  Fly   502 TTGTTNTQQPNTSMGSQSQIKNLLYLYNSE---P-RIDRNMDPLIWW--RSNIKYISLYGIVRKF 560
            ...||..:|..    |.|.|:..:..|..|   | ..|...|   :|  :|:..|.||.......
Zfish   549 KCRTTRPKQKT----STSNIRQQIIKYKEELSHPITEDTGTD---FWLGKSDSVYHSLKPFALDL 606

  Fly   561 LSAPAASVVSEGLF 574
            |:.||:...:|.:|
Zfish   607 LAMPASQAFAERVF 620

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13775NP_001285694.1 zf-BED 6..48 CDD:280965 12/43 (28%)
Dimer_Tnp_hAT 525..603 CDD:283379 15/57 (26%)
si:dkey-13n23.3XP_001340716.5 ZnF_BED 19..61 CDD:214746 13/58 (22%)
DUF659 <219..330 CDD:309874 25/118 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1121
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D223749at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
43.880

Return to query results.
Submit another query.