DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and IRR1

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:NP_012238.1 Gene:IRR1 SGDID:S000001288 Length:1150 Species:Saccharomyces cerevisiae

Alignment Length:1310 Identity:261/1311 (20%)
Similarity:473/1311 (36%) Gaps:388/1311 (30%)


  Fly     1 MMARRGGKRIRMDDPPPDYEELHSDALNESTSDADS-----PTKRMTRLRARGGVRDKPPIIDD- 59
            |.|.|...|||.....  .||.:.|..|.|....:|     .|:.........|..::....|| 
Yeast     1 MTAVRRSTRIRTKSQV--IEEDYDDEQNTSAQHVESDKITAKTQHEEEEEQDTGESEESSSEDDY 63

  Fly    60 ---DEDDFFAPIARKRKTPATRKGPTERKERVERPRKEPVDKG----------HHERIDSER--E 109
               |:||:......|||: ..||..:......:|.:|:|....          |..:.|.::  |
Yeast    64 EDQDDDDYVDTATAKRKS-RKRKPKSASNTSSKRQKKKPTSAQKSAVSHAPAYHRSKKDQDQYLE 127

  Fly   110 ITTD--ENSLYYIVRHSKN-PIASIVDQWIEQYKANRETALVALMQFFINASGCKGKISE-DIQY 170
            |..|  ...|:.|:..|:: .|..::.:|:|.|..||:..|...:...:|..|...::.: |:  
Yeast   128 IAKDFQPTELFDILSTSEDVSIEELLREWLETYSENRDKFLQEFINLLLNCCGSVARVEDHDV-- 190

  Fly   171 PVDHTSIIRRMTEEFDEESGE-------------YPLIMSGTQWRK-FK-----NNFCDFVQTLV 216
               |::      |..:|..||             |.||....:.|| ||     .||.:|:..|:
Yeast   191 ---HSN------ESSNETIGEIQLLFQRQKLHEFYLLISKENKKRKNFKMGPLYQNFAEFMTKLL 246

  Fly   217 KQC-QYSIIY-------DQFLMDN-VISLLTGLSD---SQVRAFRHTATLAAMKLMTALVDVALL 269
            :.. ...::|       .|.:..| |:.|||.||.   .::|.||:.:||........|...|:.
Yeast   247 EVANDLQLLYVESDEDDTQIVTGNLVLDLLTWLSSFSVCKIRCFRYISTLTLYLFQDYLTQQAVN 311

  Fly   270 VSNNF-DNAAKQFEAERVKSR-DRRASDRLDSLMTKRSELEENMDEIKSMLTYMFKSVFVHRYRD 332
            :..|: ...:||...|..|.| :.:..::|:|.:   :|.:.:...|.|::..:.|..|||||:|
Yeast   312 LEKNYLAKLSKQLSLEEKKKRPNNKTLEKLESTI---AETQGSKVVIDSIIDNIVKLCFVHRYKD 373

  Fly   333 SLPDIRAICMAEIGIWMENYPQNFLDDSYLKYIGWTLHDKIGEVRLRCLQSLLPLY-----EKDE 392
            ....||:..|..:.||::|||:.||..::|||.||.|.|....|||:..:.|..|.     .|..
Yeast   374 VSDLIRSESMLHLSIWIKNYPEYFLKVTFLKYFGWLLSDNSVSVRLQVTKILPHLIIQNHNSKST 438

  Fly   393 LKGKLELFTSKFKDRIVAMTL-DKEFEVSVHAVKLVISILKIHPEILADKDCEIVYELVYSSH-- 454
            ....:.....:||.:|:.:.: |...:|.:|:::::.....:  ..|.|.:..|:..|::...  
Yeast   439 DNSAIRQVFERFKTKILEVAIRDVNLDVRIHSIQVLTEASSL--GYLDDSEILIISSLMFDEEFD 501

  Fly   455 ----------------------RGVAQAAAEFLNVR----------------------------- 468
                                  |.:.:...||:...                             
Yeast   502 PFKTSSFNKRSKFLSTVAKFLARVIKEKFDEFIKTHEDLPKEVDGLEVGPVVQVGIFIKILNDSL 566

  Fly   469 LFHLTADMEETKTKRGKVRMPNTPLVRDLVQFFIESELHEHGAYLVDSFIDSNDMVRDWECMTDL 533
            ::|| .|..|..: |.|:||        |.|          .|..:..:|.::     .:.:.:|
Yeast   567 IYHL-KDCAEVDS-RTKIRM--------LTQ----------AAEFLSPYISTH-----LKTICNL 606

  Fly   534 LLEEPGPNEEVLDNKQESTLIEIMVSSVKQSATGEVPVGRASNRKCTLSAKELKAIQDEKAKLTE 598
            |:.:...||          ||:.:.:|...::..|                   .:.||:..:|.
Yeast   607 LISDTESNE----------LIQKLQNSANNNSDDE-------------------DVDDEELDITP 642

  Fly   599 HFIVTLPSLL---------------EKYQA-DSEKLANLLAVPQYFDLNLYTTNRQEGNLQALLD 647
            .|.:...|.:               .|.|. ||.|   .:.:|.::||           |.|   
Yeast   643 LFPIDRNSTILYLNVFHGLCAGANNPKIQTKDSVK---EIVLPLFYDL-----------LNA--- 690

  Fly   648 RINQVMSMHTGREVLETCAKTLECLCAEGSATYTRCNIARSNIIESAVNKYKDAIEEWRNLIQGE 712
                            ...::.:.||.               ::||.:.   .::::|.::  |.
Yeast   691 ----------------ASIESADILCP---------------LLESFIT---FSLDDWISI--GY 719

  Fly   713 ETPNEDDIYNIT-ITLKVL--SILYSSHNLNPWELFKSLFQDVEEAQSKENIDRCLPNEALVYCI 774
            ||    ::..|| .|:|..  |.:.:|.....:::|......:...:.||..::.|         
Yeast   720 ET----ELKKITDKTIKAFMDSTIGNSKVDMKYDIFAKFIHHIHHFEKKELQEKFL--------- 771

  Fly   775 EACYFSISWGLQYVENECESVNVTEVVAELRNNLDTFMGACFE--LTRDGPTVQIQEAAYQSI-C 836
                           |:         :|.|:.:|..|:....:  .:||.         |:.: |
Yeast   772 ---------------NQ---------IATLKIHLKKFLQEKMDPNNSRDD---------YKDLTC 803

  Fly   837 DLLIIFSDKLARSEIEHIRGLEYKSRMDEHLI---LDNFVQHYVFSLKQDVAQDETRIEELHKKR 898
            .|..::.:||.      |.|.:|...:||.|:   |:|||.. :..:.||.  |::..:|::.|.
Yeast   804 SLYELYINKLT------ILGRDYPIEVDEELLQLFLNNFVSR-IPIMFQDF--DDSTAQEINFKM 859

  Fly   899 NFLACYCKLVVYNIIPTMRAASIFKYYVKCYNDYGDIIKATLGK-----AREINKVNFAMTLLLS 958
            ..|     |..:|:       ..::..::...||.:.|...|..     |..|.::|   ||::|
Yeast   860 LVL-----LATWNL-------EKWREIIEKVRDYENSISKDLRSVWKPIAAIIGRLN---TLVIS 909

  Fly   959 LITVFKSLQEQSEDGIVSKSS-QEFVDLKELAKRFALTFGFDAIKNRESVAA-----IHRGG--- 1014
            |....::.:..:....:..|: ...:|:....|.|.|....||...|.|::.     :|...   
Yeast   910 LAATNETFENINSLFYLKWSACTSLMDIIVAIKIFELKLPADATTWRYSMSEQFPFYLHDNASKV 974

  Fly  1015 -----IY----FAANKEPDDPVR-----------APTRLLFLEVLNEFNYKLLKQDKKVIMSFLD 1059
                 :|    ||  |:.|..:.           .|....|..:..||....:|....:.::.||
Yeast   975 LLKIFLYLESLFA--KQVDVQLERVADEDANLNDLPETGFFENIETEFLLFTVKLKGLMKLNILD 1037

  Fly  1060 KIIPPAMPSSRAEEWQPLILYRNSLLHGETDQAPVASKRAYTRKRRDHDEEE--------EEEED 1116
            :.....:..:: |:..||.   ..::.....:.|..:|:...:.:.:..:.|        |.|.|
Yeast  1038 ERFASRVALNK-EKLGPLF---KKIVDDTIMENPEPNKKNIQKAKSNQTQREKAPLQPNSERETD 1098

  Fly  1117 --EEEHNDPD 1124
              ..|:||||
Yeast  1099 HANTENNDPD 1108

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 36/141 (26%)
IRR1NP_012238.1 IRR1 74..881 CDD:227824 196/998 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62948803
eggNOG 1 0.900 E1_COG5537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 1 1.000 T1136506
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11199
Phylome 1 0.910 0.833 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3773
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.