DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and SCC3

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:NP_566119.1 Gene:SCC3 AraportID:AT2G47980 Length:1098 Species:Arabidopsis thaliana

Alignment Length:1211 Identity:293/1212 (24%)
Similarity:516/1212 (43%) Gaps:233/1212 (19%)


  Fly     5 RGGKRIRMDDPPPDYEELHSDALNESTSDADSPTKRMTRLRARGGVRDKPPIIDDDEDDFFAPIA 69
            :|.||.|  ||..|.::...:|.....|..::..:...:             |:.|:|||     
plant     6 QGLKRSR--DPDQDQDDDSGEAGKADGSGGENQERSSDQ-------------IELDDDDF----- 50

  Fly    70 RKRKTPATRKGPTERKERVERPRKEPVDKGHHERIDSEREITTDENSLYYIVRHSKNPIASIVDQ 134
                        .|.:.:.:|.|..|                 .:.:|..:|:.:.:.|:..|..
plant    51 ------------QETRPKPKRSRTHP-----------------PQQNLIEVVKGNGDLISKAVKI 86

  Fly   135 WIEQYKANRETALVALMQFFINASGCKGKISEDIQYPVDHTSI---------IRRMTEEFDEESG 190
            |:|:|:.:...|...|:.....|.|.|..|.:|:   :|.|.:         :.|..|..|.:|.
plant    87 WVERYEDSPSLATTELLSMLFQACGAKYSIKDDL---LDETDVDDVVVSLVNLARAGELEDYQSS 148

  Fly   191 EYPLIMSGTQWRKFKNNFCDFVQTLVKQCQYSIIYDQFLMDNVISLLTGLSDSQVRAFRHTATLA 255
            .      ..:.:.||.|...|...|:.:||...::|:.|.|..:..:..||.:..|.:|.||||.
plant   149 R------KKELKNFKENLVSFWNNLIIECQNGPLFDRVLFDKCMDYIIALSCTPPRVYRQTATLM 207

  Fly   256 AMKLMTALVDVALLVSNNFDNAAKQFEAERVKSRDRRASDRLDSLMTKRSELEENMDEIKSMLTY 320
            .::|:|:.:.||..:.:..:...:|..||   |:.|....|:|||..:.|...|.:..::.|:..
plant   208 GLQLVTSFISVANTLGSQRETTQRQLNAE---SKKRADGPRVDSLNKRLSVTHEQITTLEDMMRK 269

  Fly   321 MFKSVFVHRYRDSLPDIRAICMAEIGIWMENYPQNFLDDSYLKYIGWTLHDKIGEVRLRCLQSLL 385
            :|..:|||||||...|||..|:..:|||:.:||..||.|.||||:||||:||...||...|.:|.
plant   270 IFTGLFVHRYRDIDNDIRMSCIQSLGIWILSYPSLFLQDLYLKYLGWTLNDKNAGVRKASLLALQ 334

  Fly   386 PLYEKDELKGKLELFTSKFKDRIVAMTLDKEFEVSVHAVKLVISILKIHPEILADKDCEIVYELV 450
            .|||.||....|.|||.:|.:|::.|..|.:...:|.|:.||..:|: | :::.|.|...:|:|:
plant   335 KLYEMDENVPTLGLFTQRFSNRMIEMADDVDMSAAVCAIGLVKQLLR-H-QLIPDDDLGPLYDLL 397

  Fly   451 YSSHRGVAQAAAEFLNVRLFHLTADM-----------EETKTKRGKVRMPNTPLVRDLVQFFIES 504
            ....:.:.:|..|.:   ..||.|..           :::.::....||     ::.|.:|..:.
plant   398 IDQPQEIRRAIGELV---YDHLIAQKFNSSPSSLTGHDDSSSEIHIFRM-----LQILREFSTDP 454

  Fly   505 ELHEHGAYLVDSFIDSNDMVRDWECMTDLLLEEPGPNEEVLDNKQESTLIEIMVSSVKQSATGEV 569
            .|   ..|::|...:....::||:|:..:||:: .|......::..:.||.::..|::: |.||.
plant   455 IL---CVYVIDDVWEYMKAMKDWKCIISMLLDQ-NPRTGSTTDEDSTNLIRLLFVSIRK-AVGEK 514

  Fly   570 PVGRASNRKCTLSAKELKAIQDEKAKLTEHFIVTLPSLLEKYQADSEKLANLLAVPQYFDLNLYT 634
            .:....|||...|..:.:..::.:..:|...:...|.||.|:.||..|:::|:.:..:..|.||:
plant   515 IIPSTDNRKQYHSKAQREIFENNRKDITVAMMKNYPQLLRKFMADKAKVSSLVEIIIFMKLELYS 579

  Fly   635 TNRQEGNLQALLDRINQVMSMHTGREVLETCAKTLECLCAEGSATYTRCNIARSNIIESAVNKYK 699
            ..|||.:.:|.:..|......|..:|.|.:|.|.: ..||..|         :..:.:.:..|.|
plant   580 LKRQEQSFKAAVRLIKDAFFKHGEKEALRSCVKAI-TFCASES---------KGELQDFSRGKLK 634

  Fly   700 DAIEEWRNLIQG--EETPNEDDIYNITITLKVLSILYSSHNLNPWELFKSLFQDVEEAQSKENID 762
            |..:|..:.|..  .|..:.:|.|::.:.||.|..|..|..:    |.:|:|.::  |.:..|. 
plant   635 DLEDELLDKITSAIREVKDGNDEYSLLVNLKRLYELQLSKPV----LVESMFDEI--ALTLHNF- 692

  Fly   763 RCLPNEALVYCIEACYFSISWGLQYVENECESV---NVTEVVAE---LRNNLDTFMGACFELTRD 821
            |.|..|.:.:.:...:..::|.|..:.| ||::   :::.::::   |...|..|:....|..:.
plant   693 RNLDEEVICFLLLNMHMYLAWYLHSIIN-CEAISEASLSSLISKRDTLFEELSYFLNGIEESKKY 756

  Fly   822 GPTVQIQEAAYQSICDLL----IIF------SDKLARSEIEHIRGLEYKSRMDEHLILDNF--VQ 874
            |..:.      ..||.:|    .:|      |.||.|        |.|   ..:.:.|:.|  :.
plant   757 GNQLS------NRICAILAETWCLFRKSNYDSGKLER--------LGY---CPDSVFLEKFWKLC 804

  Fly   875 HYVFSLKQDV-AQDETR--IEELHKKRNFLACYCKLVVYNIIPTMRAASIFKYYVKCYNDY-GDI 935
            ..:|:...:. .:||.:  |||.::..:.:|. ||||..:::|               .|| |..
plant   805 AEMFNTSDETDEEDENKEYIEETNRDVSVIAA-CKLVASDVVP---------------KDYLGPE 853

  Fly   936 IKATLG-------------------KAREINKVNFAMTLLLSLITVFKSLQEQSEDGIVSKSSQE 981
            |.:.||                   |..:|:.: :..:|..:.......|....|:..|.|..:|
plant   854 IISHLGMHGPGVTGIIKNLITFLRKKEDDISNI-YLESLKRAYHRYSSELSSGREESRVDKCLEE 917

  Fly   982 FVDLKELAKRFA-LTFGFDAIKNRESVAAIHRGGIYFAANKEPDDPVRAPTRLLFLEV-LNEFNY 1044
            :   :|||...: :..|....|.|..:.::.:.|:.||...       ||.:|||||| :..|..
plant   918 W---RELAGGLSGMYIGAARNKYRLEILSVVKEGVEFAFRD-------APKQLLFLEVAILPFAT 972

  Fly  1045 KLLKQD----KKVIMSFLDKIIPPAMPSSRAEEWQPLILY---------RNSLLHGETDQAPV-- 1094
            :|...|    ||.:...:..:.....||.    |:|...:         :|..|..:.:.|.|  
plant   973 RLSVSDIIDIKKDVQGRIVHVNTDEDPSG----WRPCFTFLETLEEKCLKNEDLQDDKEAANVRR 1033

  Fly  1095 ---ASKRAYTRKRRDHDEEEEEEEDE--------EEHNDPD 1124
               ..||..|.::|..||:...:|||        |:..|.|
plant  1034 RGRPRKRPETERKRLFDEQSGSDEDESISGGSDREDKLDED 1074

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 28/108 (26%)
SCC3NP_566119.1 IRR1 87..>482 CDD:227824 123/420 (29%)
STAG 143..247 CDD:285686 30/113 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H21191
Inparanoid 1 1.050 264 1.000 Inparanoid score I929
OMA 1 1.010
OrthoDB 1 1.010 D167826at2759
OrthoInspector 1 1.000 T125226
orthoMCL 1 0.900 OOG5_127983
Panther 1 1.100 LDO PTHR11199
Phylome 1 0.910 0.857 Consistency score
98.980

Return to query results.
Submit another query.