DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and stag2a

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:NP_001093498.1 Gene:stag2a ZFINID:ZDB-GENE-030131-3432 Length:1246 Species:Danio rerio

Alignment Length:1123 Identity:485/1124 (43%)
Similarity:692/1124 (62%) Gaps:93/1124 (8%)


  Fly    20 EELHSDALNES---TSDADSPTKRMTRLRARGGVRDKPPIIDDDEDDFFAPIARKRKTPATRKGP 81
            :||.:|...|.   .||.|                     ::|.|       .|..|....:||.
Zfish     5 QELQADFYQEGHSLLSDTD---------------------LEDHE-------GRNGKLAKGKKGK 41

  Fly    82 TERKERVERPRKEPVDKGHHERIDSEREITTDENSLYYIVRHSKNPIASIVDQWIEQYKANRETA 146
            ....|:::.........|||:..|.|      ..||:.|||..|:...|:||.|||.||.:|::|
Zfish    42 KSIGEKLKGSEVRGRVNGHHQENDME------NLSLFEIVRLGKSATQSVVDDWIESYKTDRDSA 100

  Fly   147 LVALMQFFINASGCKGKISEDIQYPVDHTSIIRRMTEEFDEESGEYPLIMSGTQWRKFKNNFCDF 211
            |:.|:.|||:.|||||.:|.::...:.::.|||:|||||||:||:|||.|:|..|:|||.|.|:|
Zfish   101 LLELINFFIHCSGCKGTVSFEMFRNMQNSEIIRKMTEEFDEDSGDYPLAMAGPAWKKFKTNLCEF 165

  Fly   212 VQTLVKQCQYSIIYDQFLMDNVISLLTGLSDSQVRAFRHTATLAAMKLMTALVDVALLVSNNFDN 276
            :.|||:|||||||||:::||.:||||||||||||||||||:||||||:|||||:|||.:|.|.||
Zfish   166 IATLVRQCQYSIIYDEYMMDTLISLLTGLSDSQVRAFRHTSTLAAMKMMTALVNVALNLSINLDN 230

  Fly   277 AAKQFEAERVKSRDRRASDRLDSLMTKRSELEENMDEIKSMLTYMFKSVFVHRYRDSLPDIRAIC 341
            ..:|:|.||.||..:||::||:.|:.||.||:||.|||::|:..:||.||:|||||.:.:||.:|
Zfish   231 TQRQYETERNKSIGKRANERLELLLQKRKELQENQDEIENMMNAIFKGVFIHRYRDVIAEIRVVC 295

  Fly   342 MAEIGIWMENYPQNFLDDSYLKYIGWTLHDKIGEVRLRCLQSLLPLYEKDELKGKLELFTSKFKD 406
            :.|||:||:.|.:.||:||||||:|||::||.|||||:||.:|..||...||..:||||||:|||
Zfish   296 IEEIGMWMKMYSEAFLNDSYLKYVGWTMYDKQGEVRLKCLTALQGLYYSRELNARLELFTSRFKD 360

  Fly   407 RIVAMTLDKEFEVSVHAVKLVISILKIHPEILADKDCEIVYELVYSSHRGVAQAAAEFLNVRLFH 471
            |||:||||||::|:|.|:||:..:|:...|:|..:|||.||.||||:||.||.||.|||..:||.
Zfish   361 RIVSMTLDKEYDVAVQAIKLLTLVLQSSDEVLMAEDCESVYHLVYSAHRPVAVAAGEFLYKKLFS 425

  Fly   472 LTADMEETKTKRGKVRMPNTPLVRDLVQFFIESELHEHGAYLVDSFID-SNDMVRDWECMTDLLL 535
            .....:|.:.:||: :..|..|:|..|.||:||||||||||||||..| ::::::|||.|..|||
Zfish   426 HHGPEDEGRPRRGR-QCLNANLIRTTVLFFLESELHEHGAYLVDSLWDCASELLKDWESMISLLL 489

  Fly   536 EEPGPNEEVLDNKQESTLIEIMVSSVKQSATGEVPVGRASNRKCTLSAKELKAIQDEKAKLTEHF 600
            :||.|.||.|.:.||..|||||..:|:|:.....|:||.:.:: .|:|||.|...|::.|:||.|
Zfish   490 DEPFPGEEALSDAQEVALIEIMFCAVRQTCECHPPIGRGTGKR-VLTAKEKKTQLDDRTKITETF 553

  Fly   601 IVTLPSLLEKYQADSEKLANLLAVPQYFDLNLYTTNRQEGNLQALLDRINQVMSMHTGREVLETC 665
            .|.||.||.||..|.||:.|||..|:||||.:|||.|.|.:|.|||.::..|:..||..:|||.|
Zfish   554 AVALPLLLAKYSMDPEKVTNLLQFPRYFDLEIYTTGRLEKHLDALLRQVRDVVEKHTDTDVLEAC 618

  Fly   666 AKTLECLCAEGSATYTRCNIARSNIIESAVNKYKDAIEEWRNLIQGEETPNEDDIYNITITLKVL 730
            :.|.:.||.:....|.|.::.||.:::..::|:...:|::  |::||| |:|||.|.:..|||.:
Zfish   619 SMTFQALCNDEFTIYNRVDLVRSQMLDEQIDKFHRLLEDF--LLEGEE-PDEDDTYQVLSTLKRI 680

  Fly   731 SILYSSHNLNPWELFKSLFQDVEEAQSKENIDRCLPNEALVYCIEACYFSISWGLQYVENECESV 795
            :..:::|:|..|:||.|.::.:.  ...:|.|  :|.:.:.:.::..::.|.|.|..|..  .|.
Zfish   681 TAFHNAHDLTKWDLFTSNYRLLN--SGLQNGD--MPEQIVAHALQCTHYVILWHLAKVSE--GSA 739

  Fly   796 NVTEVVAELRNNLDTFMGACFELTRDGPTVQIQEAAYQSICDLLIIFSDKLARSEIEHIRGLEYK 860
            :..::|. ||..:..|...|........|. ::|.|:..:||.|:|||.::..|..|.:..|.:.
Zfish   740 SKDDMVL-LRRQVRAFCLMCQRYLNSMSTA-VKEQAFTILCDALLIFSYQIVASGREILEPLVFS 802

  Fly   861 SRMDEHLILDNFVQHYVFSLKQDVAQDET--------RIEELHKKRNFLACYCKLVVYNIIPTMR 917
            ........|.||:..:||     |.|||.        :||.||::||.||.:|||:::|::....
Zfish   803 PDASLQSELLNFILDHVF-----VEQDEDGSTDDEAGKIEALHRRRNLLAAFCKLIIFNVVEMKT 862

  Fly   918 AASIFKYYVKCYNDYGDIIKATLGKAREINKVNFAMTLLLSLITVFKSLQEQSEDGI-VSKSSQE 981
            .|.:||.|::.|.|||||||.|:.|||:|:|:..|.||:|||..:|..:  .|:.|. ..:|:..
Zfish   863 GADVFKQYMRYYTDYGDIIKETMSKARQIDKIQCAKTLILSLQQLFNEM--LSDLGCNFDRSTSA 925

  Fly   982 FVDLKELAKRFALTFGFDAIKNRESVAAIHRGGIYFAANKEPDDPVRA--PTRLLFLEVLNEFNY 1044
            |..:||||:|||||||.|.:|.||::|.:|:.||.||. |||......  |..|.||::|:||:.
Zfish   926 FCGIKELARRFALTFGLDQLKTREAIAMLHKDGIEFAF-KEPSPQGEGGPPLNLAFLDILSEFSS 989

  Fly  1045 KLLKQDKKVIMSFLDKIIPPAMPSSRAEEWQPLILYRNSLLHGETD------------------- 1090
            |||:||||.:..:|::.:...|...|.:.|.|||.|||||..|..|                   
Zfish   990 KLLRQDKKTVHVYLERFMTFQMALQRDDCWLPLISYRNSLQAGADDDTLSVISGMSRSSARSRRG 1054

  Fly  1091 QAPVASKRAYTRKRRDHD 1108
            :.|.|||    ||..|.|
Zfish  1055 KPPAASK----RKLPDED 1068

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 73/108 (68%)
stag2aNP_001093498.1 STAG 144..252 CDD:285686 73/108 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62836928
eggNOG 1 0.900 E1_COG5537
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 920 1.000 Inparanoid score I339
OMA 1 1.010
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 1 1.000 T597592
orthoMCL 1 0.900 OOG5_127983
Panther 1 1.100 O PTHR11199
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.770

Return to query results.
Submit another query.